KEGG   Mycobacterium chubuense: Mycch_1341Help
Entry
Mycch_1341        CDS       T02150                                 

Definition
coenzyme F420-0 gamma-glutamyl ligase (EC:6.3.2.31)
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mcb  Mycobacterium chubuense
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mycch_1341
Enzymes [BR:mcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Mycch_1341
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Mycch_1341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1370844..1372184)
Genome map
AA seq 446 aa AA seqDB search
MSDHGTSARIELLPVAGLPEFRPGDDLGAAIAEAAPWLQDDDIVVVTSKVLSKCEGRMVD
APADPELRDTLRRKLIDGEAVRVLARKGRTLITENALGLVQAAAGVDGSNVDSHELALLP
VDPDGSAALLRGQLWERLGVRVGVVVTDTMGRAWRTGQTDVAIGAAGLTVLHAYAGEHDQ
HGNELIVTEIAVADEIAAAADLVKGKLTAVPVAVVRGLALRDDGSSARHLVRAGEEDLFW
LGTDEAIALGRSQAQLLRRSVRRFRGDPVAADLIEAAVAEALTAPAPHHTRPVRFVWVQD
TSVRVGLLDRMKDQWRADLSGDGRDADSVERRVSRGQILYDAPELIIPFMVPDGAHSYPD
AQRTAAEHTMFTVAVGAAVQALLVALAVRGVGSCWIGSTIFAPDLVRAELGLPPEWEPLG
AIAIGYAEEPADPRDPVPVEGLLVRK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatcacggcacgtcggcgcgcatcgagctgctgccggtggccggactgcccgag
ttccggccgggcgacgacctgggcgccgccatcgccgaggccgccccgtggctgcaggac
gacgacatcgtcgtcgttaccagcaaggtgctgtcgaagtgcgagggccgcatggtcgat
gcaccggccgatccggagctgcgggacacgttgcgccgcaagctgatcgacggcgaggcg
gtgcgggtgctggcgcgcaagggccgcacgctgatcaccgagaacgcgctcggcctggtg
caggccgccgccggggtggacggctcgaacgtcgactctcacgaactcgcactgctgccc
gtcgatccggacggcagcgccgcgctgctccgaggtcagctgtgggaacgcctcggcgtg
cgcgtcggcgtcgtcgtcaccgacacgatgggccgggcgtggcgcaccggtcagaccgac
gtcgcgatcggcgcggccggcctgaccgtgttgcacgcctatgccggtgaacacgatcag
cacggcaacgagttgatcgtcaccgagatcgccgtcgccgacgagatcgccgcggccgcg
gatctggtgaagggcaagctgaccgcggtgccggtggcggtggtgcgggggctggcgctg
cgcgacgacgggtcctcggcgcgccacctggtgcgcgccggcgaggaggacctgttctgg
ctcggcaccgacgaggccatcgcgctgggccgttcgcaggcgcagctgctgcggcgctcg
gtgcgccgcttccgcggtgacccggtcgccgcggatttgatcgaggcggcggtggcggag
gcgttgacggccccggcgccgcaccacacccggccggtgcggttcgtgtgggtgcaggac
acctcggtgcgtgtggggttgctcgaccggatgaaggaccagtggcgagccgacctgtcg
ggcgacggtcgcgacgccgactccgtcgaacgccgggtttcgcgcggccagatcctctac
gacgcgccggagctgatcattccgttcatggtgcccgacggcgcgcacagctatcccgac
gcgcagcgcaccgccgccgagcacacgatgttcaccgtggcggtgggcgcggccgtgcag
gcgttgctcgtcgcgctggccgtgcgcggggtgggcagctgctggatcgggtcgacgatc
ttcgcccccgacctggtgcgcgccgaactcggcctgccgccggagtgggaaccgttgggc
gccatcgcgatcggctacgccgaggaaccggcggacccgcgcgacccggtgcccgtcgag
ggcctgctggtgcgcaagtga

DBGET integrated database retrieval system