KEGG   Mycobacterium chubuense: Mycch_1504Help
Entry
Mycch_1504        CDS       T02150                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00010  Glycolysis / Gluconeogenesis
mcb00030  Pentose phosphate pathway
mcb00051  Fructose and mannose metabolism
mcb00052  Galactose metabolism
mcb00680  Methane metabolism
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
mcb01230  Biosynthesis of amino acids
Module
mcb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_1504
   00030 Pentose phosphate pathway
    Mycch_1504
   00051 Fructose and mannose metabolism
    Mycch_1504
   00052 Galactose metabolism
    Mycch_1504
  Energy metabolism
   00680 Methane metabolism
    Mycch_1504
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mycch_1504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AFM16304
UniProt: I4BG97
Position
1549180..1550148
Genome map
AA seq 322 aa AA seqDB search
MPSRDAIVTLTMNPALDVTADAGEVRPTDKIRCTADRYDPGGGGVNVARFAQALGATVEA
VFPAGGLTGARFIDLVTAAGIPNSPVFIHGSTRESFTVNERTTGKQYRFVLPGPRLSPSE
QDRCLEKLRAAAVSARFVVASGSLPPGVPPDFYQRVGQICREADVPLILDTSGGGLARVT
SGVAVLKPSVRELRECVGRPLQTEDEQLDAARELIERGVTRAVVVSLGADGALLATAQDS
ERFPALPVHAISGVGAGDAMVAAIAVGLCRDWSLSKAVRYGMAAGTAKLLAPGTAVFSRA
DVERFFEMACSRPGGDRSAATV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgccgagccgcgatgccatcgtcacgttgacgatgaaccccgcgctggacgtcaccgcc
gacgccggtgaggtccggcccaccgacaagatccgttgcaccgcagaccgatacgacccc
gggggcggtggggtcaacgtcgcgcggttcgcccaggcgctcggcgcgaccgtggaggcg
gtgttccccgccggcggcctcaccggtgcgcggttcatcgacctcgtcacggccgcgggg
ataccgaactcacccgtgttcatccacggctcgacacgggagagtttcaccgtcaacgag
cggaccaccggcaagcagtaccggttcgtcctgcccgggcctcggttgtcgccctcggag
caggaccggtgcctcgaaaagttgcgggctgcggccgtctccgcgaggttcgtcgtggcc
agcggcagtctgccacccggtgtgccccccgacttctaccagcgcgtcggccagatctgc
cgcgaggcggacgtcccgctgatcctcgacacctccgggggtgggctggcccgtgtcacg
tcgggggtggccgtgctgaaaccgagcgtgcgcgaattgcgcgaatgcgtcggccggccg
ctgcagaccgaggacgaacaactcgacgccgctcgcgagctcatcgagcgcggtgtcacg
cgtgcggtcgtggtgtcgctgggcgccgacggcgcactgctggcgaccgcgcaggacagc
gagcgcttcccggcgctgccggtgcacgcgatcagcggcgtcggcgccggcgacgccatg
gtggccgcgatcgccgtcgggctctgccgcgactggtcgctcagcaaagcggtgcggtac
ggaatggcggcgggcacagcgaagctgctcgcgccgggcaccgcggtgttctcccgcgcc
gacgtcgagcgattcttcgagatggcctgctctcggcccggcggagacagatcggcggcc
accgtctga

DBGET integrated database retrieval system