KEGG   Mycobacterium chubuense: Mycch_1589Help
Entry
Mycch_1589        CDS       T02150                                 

Definition
succinate dehydrogenase/fumarate reductase flavoprotein subunit
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mcb  Mycobacterium chubuense
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mycch_1589
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     Mycch_1589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1640975..1642453)
Genome map
AA seq 492 aa AA seqDB search
MRVDDAGHGGVTPIPAAAVTSWDHHADVVIAGYGVAGAAAAVEAARAGADVLVLERSGSW
GGAAAMAGGFIYLGGGTPIQKACGFADSVDNMAAFLNAAMGPGADEHRIADYCAGSVAHF
EWLTGCGVPFKAEFFDQPGWEPMGDEGLMYSGGENSFPFNTIAEPAPRGHVPQMQNKKQG
ESSAGLMLMTGLVDTATAAGARALYDVRVQSLIVESGGRVVGVRARRYGTSIDIRAKRGV
ILAMGSFAYNDAMVARYAPRIAGRPAASVEQHDGRAIRMAQALGADLAHMDATEVALFVD
PQQLVRGVLVNERGQRFVAEDTYPGRVGQLTLYHQNNTAYLILDETAQADAMAAPSPHLM
MRPPTWVCETVAELEAEIGLVPNSLQSTIAAYNHDAAEGRDRLLHKKSRWLRPLGSPVAA
IDLRESTGGFTLGGLHTTLDGEVLHVSGDPIPGLFAAGRCTAGLAAWGYASGVSLGDGSF
YGRRAGRAAVHA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgagggtagatgacgccggccatggaggtgtcaccccgatccccgctgccgccgtcacc
tcctgggaccaccacgccgacgtcgtgatcgccggttacggcgtcgccggcgctgcggca
gcggtcgaagccgcgcgggcgggcgccgacgtactcgtcctcgagcggtctggatcgtgg
ggcggggcggccgccatggccggcgggttcatctacctcggcggcggaacgccgatccaa
aaggcctgcggcttcgccgattccgtcgacaacatggccgccttcctcaacgccgccatg
gggccgggcgccgacgaacaccgcatcgccgactactgcgcgggcagtgtcgcccacttc
gagtggctgaccggttgcggcgttccgttcaaggccgagttcttcgatcagcccggctgg
gagcccatgggcgatgaagggctgatgtacagcggtggagagaattccttcccgttcaac
accatcgccgagcctgctccgcgcggccacgtgccgcagatgcagaacaagaagcaggga
gagtccagcgccggactcatgctgatgacgggcctggtcgataccgccaccgccgccggt
gcccgggcgctctatgacgtccgcgtgcagtcgctcatcgtcgagtccggcggccgcgtc
gtgggagtacgggcccgccgctacggcacctcgatcgacatccgagccaagcggggcgtg
atcctggccatgggtagcttcgcctacaacgatgcgatggtggcacggtatgcgccgcgc
atcgccggccggcctgccgcctccgtcgagcagcatgacggacgagcgatccggatggca
caggcgctcggcgcggacctcgcgcacatggacgccacggaggtggcgctgttcgtcgac
ccgcagcaactggtacgcggagtcctggtcaacgagcgaggtcaacgcttcgtcgccgaa
gacacctaccccggtcgggtcggtcagctcaccctctaccaccagaacaacaccgcctac
ctcatcctcgatgagaccgcgcaggccgacgcgatggccgccccctcgccgcacctgatg
atgcgcccaccgacctgggtgtgcgagaccgtcgccgaactcgaggccgagatcggactg
gtgcccaactctctgcaatccaccatcgccgcctacaatcacgacgccgccgaggggcgg
gatcgcctcctgcacaagaagtctcgctggctgcgacctctcggatcaccggtggcagcg
atcgatctgcgcgaatccaccggagggttcaccctgggcggattacacaccacactcgac
ggcgaggtactccacgtcagcggagatccgatccccggactcttcgccgcaggacgctgc
accgccggactggcggcgtggggttacgccagcggcgtctcgctgggtgacggcagcttc
tacgggcgccgcgccggccgcgccgcagtacacgcctga

DBGET integrated database retrieval system