KEGG   Mycobacterium chubuense: Mycch_1596Help
Entry
Mycch_1596        CDS       T02150                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00360  Phenylalanine metabolism
mcb00362  Benzoate degradation
mcb00620  Pyruvate metabolism
mcb00621  Dioxin degradation
mcb00622  Xylene degradation
mcb00650  Butanoate metabolism
mcb01100  Metabolic pathways
mcb01120  Microbial metabolism in diverse environments
mcb01220  Degradation of aromatic compounds
Module
mcb_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mycch_1596
   00650 Butanoate metabolism
    Mycch_1596
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Mycch_1596
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycch_1596
   00622 Xylene degradation
    Mycch_1596
   00621 Dioxin degradation
    Mycch_1596
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Mycch_1596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AFM16395
UniProt: I4BGI8
Position
complement(1649499..1650416)
Genome map
AA seq 305 aa AA seqDB search
MADKLSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLAQSERPDMVFEATSAYVHRDAAPRYAEAGIRAIDLTPAAVGPGVIPPANLREHLDAP
NVNMVTCGGQATIPIVHAVSRVVEVPYGEIVASVSSASAGPGTRANIDEFTKTTSAGVQN
IGGARRGKAIIILNPADPPMIMRDTIFCAIPDDADREAIAASIRDVVAEVQTYVPGYRLL
NEPQFDDPSINSGGQALVTTFIEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKERASAG
TGAQA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaactgtctgtggcgatcgtggggtcgggcaacatcagcaccgatctgctg
tacaagcttcttcggtcggagtggttggagccgcgttggatgatcggcatcgatcccgag
agtgaggggttggcgcgggcgcgcaagctcggcctggagaccagtcatgagggtgtggac
tggctgctcgcccagtctgagaggccggacatggtgttcgaggcgaccagcgcctacgtg
caccgtgacgccgcgccgcgctatgccgaggccggcatccgcgccatcgacctgaccccg
gctgcggtcggtccgggggtgatcccgccggcgaatctgcgcgagcatctcgatgcgccg
aacgtcaacatggtgacctgcgggggtcaggcgaccatcccgatcgtgcatgcggtgagt
cgggtcgtcgaggtgccctacggcgagatcgtggcgtcggtgtcctcggcgtcggcgggg
ccgggaacgcgggccaacatcgatgagttcaccaagaccaccagcgcgggtgtgcagaac
atcggtggcgcccggcggggcaaggcgatcatcatcttgaacccggccgacccgccgatg
atcatgcgcgacaccatcttctgtgcgatccccgacgacgctgaccgcgaggcgatcgcc
gcctcgatccgcgacgtggtggccgaggtgcagacctacgtgcccggctaccggctgctc
aacgaaccgcagttcgacgacccgtcgatcaactcgggcggccaggcgctggtcacgacg
ttcatcgaagtggagggtgcgggtgactatctgccgccctacgctggaaatctggacatc
atgaccgccgcggccaccaaggtcggcgaagagatcgccaaggagcgggcgtcggcggga
acgggagcgcaggcatga

DBGET integrated database retrieval system