KEGG   Mycobacterium chubuense: Mycch_1596Help
Entry
Mycch_1596        CDS       T02150                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mcb  Mycobacterium chubuense
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mcb00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mcb00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mcb00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mcb00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mcb00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1649499..1650416)
Genome map
AA seq 305 aa AA seqDB search
MADKLSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLARARKLGLETSHEGVD
WLLAQSERPDMVFEATSAYVHRDAAPRYAEAGIRAIDLTPAAVGPGVIPPANLREHLDAP
NVNMVTCGGQATIPIVHAVSRVVEVPYGEIVASVSSASAGPGTRANIDEFTKTTSAGVQN
IGGARRGKAIIILNPADPPMIMRDTIFCAIPDDADREAIAASIRDVVAEVQTYVPGYRLL
NEPQFDDPSINSGGQALVTTFIEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKERASAG
TGAQA
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaactgtctgtggcgatcgtggggtcgggcaacatcagcaccgatctgctg
tacaagcttcttcggtcggagtggttggagccgcgttggatgatcggcatcgatcccgag
agtgaggggttggcgcgggcgcgcaagctcggcctggagaccagtcatgagggtgtggac
tggctgctcgcccagtctgagaggccggacatggtgttcgaggcgaccagcgcctacgtg
caccgtgacgccgcgccgcgctatgccgaggccggcatccgcgccatcgacctgaccccg
gctgcggtcggtccgggggtgatcccgccggcgaatctgcgcgagcatctcgatgcgccg
aacgtcaacatggtgacctgcgggggtcaggcgaccatcccgatcgtgcatgcggtgagt
cgggtcgtcgaggtgccctacggcgagatcgtggcgtcggtgtcctcggcgtcggcgggg
ccgggaacgcgggccaacatcgatgagttcaccaagaccaccagcgcgggtgtgcagaac
atcggtggcgcccggcggggcaaggcgatcatcatcttgaacccggccgacccgccgatg
atcatgcgcgacaccatcttctgtgcgatccccgacgacgctgaccgcgaggcgatcgcc
gcctcgatccgcgacgtggtggccgaggtgcagacctacgtgcccggctaccggctgctc
aacgaaccgcagttcgacgacccgtcgatcaactcgggcggccaggcgctggtcacgacg
ttcatcgaagtggagggtgcgggtgactatctgccgccctacgctggaaatctggacatc
atgaccgccgcggccaccaaggtcggcgaagagatcgccaaggagcgggcgtcggcggga
acgggagcgcaggcatga

DBGET integrated database retrieval system