KEGG   Mycobacterium chubuense: Mycch_1816Help
Entry
Mycch_1816        CDS       T02150                                 

Definition
glycosyltransferase
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mcb  Mycobacterium chubuense
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mycch_1816
Enzymes [BR:mcb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Mycch_1816
Glycosyltransferases [BR:mcb01003]
 Polysaccharide
  Storage polysaccharide
   Mycch_1816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1885323..1886555)
Genome map
AA seq 410 aa AA seqDB search
MKVLLLSWEYPPVVIGGLGRHVHHLATELALAGHDVVVLSRRPTATDPTTHPTTDEICEG
VRVVAAAEDPHEFAFGTDMMAWTLAMGHAMVRAGLGLGDWRPDVVHAHDWLVAHPAVALA
QFFDVPLVSTIHATEAGRHSGWVAGPVSRQVHALESWLVRESDSLITCSASMRDEIGELF
GPELAEISVIRNGIDTDGWPFAERRAHSGPAELLYFGRLEYEKGVHHAIAALPRIRRTHP
GTTLTIAGDGTQLDFLTSEARRHKVLKATKFVGRVDHSQLLTLLHRADAAVLPSLYEPFG
IVALEAAAAGLPLVASTAGGLGEAVIDGVTGLSYPPDDVPALAAAVRAVLDDPSAAAQRA
TAARLRLTSDFTWQTVARETSQVYLGAKRAERRAHARLPIAERALPHRTG
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtccttctgctgtcctgggaatacccacccgtcgtgatcggcggtctcggccgg
cacgtgcaccacctggccaccgaactggcgctcgcgggtcacgacgtcgtcgtcctcagc
cgaaggccgaccgccaccgatccgacgacccaccccaccaccgacgagatctgcgagggc
gtgcgcgtcgtcgccgccgccgaggacccgcacgagttcgccttcggcaccgacatgatg
gcgtggacgctggccatgggccacgcgatggttcgcgccgggctcggtctgggcgactgg
cggcccgacgtggtacacgcccacgactggctggtcgcccatcccgccgtggcgctggcc
cagttcttcgacgtgccactggtttccaccatccacgccaccgaggcaggccggcattcg
gggtgggtggccggaccggtcagccggcaggtgcacgcgctggaatcgtggctggtgcgc
gaatccgattcgctgatcacgtgttcggcgtcgatgcgcgacgagatcggcgaactgttc
ggcccggagctcgccgagatctcggtcatccgcaacggtatcgacaccgacggctggccg
ttcgccgagcgccgcgcgcattccggcccggccgaactgctgtacttcggccgcctggag
tacgagaagggcgtccaccacgcgatcgccgccctgccgcgcatccggcgcacccacccc
ggcacgaccctgaccatcgccggcgacggcacgcagctggacttcctgacctccgaggcg
cgcagacacaaagtgctcaaggcgacgaaattcgtcgggcgcgttgatcattcgcagctg
ctgacattgctgcaccgcgccgacgccgcggtactgccctcgctctacgagccgttcggc
atcgtggcgctcgaggctgccgcggcaggtctgccgctggtcgcctccaccgccggcggc
ctcggcgaggccgtgatcgacggcgtcaccggcctgtcgtatccaccggacgacgtgccg
gcgctggccgcagcggtccgcgccgtactcgacgacccgtcggctgccgcgcagagggcg
acggctgctcgactgcggctcacgtcggacttcacctggcagaccgtggcccgcgagacc
tctcaggtctacctgggcgccaagcgggcggagcggcgtgcacacgcgcgccttccgatc
gccgaacgcgcgctgccgcaccggaccggctga

DBGET integrated database retrieval system