KEGG   Mycobacterium chubuense: Mycch_1817Help
Entry
Mycch_1817        CDS       T02150                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mcb  Mycobacterium chubuense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mycch_1817
Enzymes [BR:mcb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mycch_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1886558..1888132)
Genome map
AA seq 524 aa AA seqDB search
MTPSDPEPVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSASYLPLVRVLRTLAAEGR
GRLVTLGVTPVVAAQLDDPYCLQGMHHWLANWQLRALEAATMRSTSDPSPASAPEALRRF
GSREHDEAERELGEFETLWRHGGSPVLRELIDDGVIELLGGPLVHPFQPLLNPRLRDFAL
REGLADARQRFAHTPTGIWAPECAYAPGMESDYAAAGIGHFMVDGPSLHGDTALGRPVAG
SDVVAFGRDLQVSYRVWSPRSGYPGHAAYRDFHTYDHATGLKPARVTGRNVPSDAKAPYD
PERADAAVDAHVADFVDTVRQRLSTESARIGRPAHVIAAFDTELFGHWWYEGPVWLERVL
RALPAAGIRVGTLSDAVAGGYVGTPVELPPSSWGSGKDWQVWAGEKVADLVQLNTEVVDA
ALSTVDKALAEPAAVGAPTPRSFVADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLH
AHATREIAGALASGRTEQAQRLAEGWNRADGLFGALDARRLPSP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccttccgatcccgagccggtaccggggctgttcacgctggtgctgcacacccat
ctgccctggctcgcccaccatggccggtggccggtgggcgaggagtggctctaccagtcg
tggtcggcgtcgtatctgcccctcgtgcgggtgctccgcaccctggccgccgaaggtcgc
ggccggctggtgacattgggcgtcacgccggtggtggccgcccagctcgacgacccgtac
tgcctgcagggcatgcaccactggctcgccaactggcaactgcgcgcgctggaagccgcg
acgatgcggtcgacgtcggatccgtcgcccgcctcagcgccggaagcgttgcggcgcttc
ggatctcgggaacacgacgaggcggagcgggaactcggcgagttcgagacgctgtggcgc
cacgggggcagcccggtgctgcgggaactcatcgacgacggcgtcatcgagttgctcggc
ggaccgctggtacatccgttccagccgctgctcaacccccggctgcgcgatttcgcgctg
cgcgaggggctcgccgacgcccggcagcggttcgcgcacaccccgacgggcatctgggcg
cccgaatgcgcctacgcgcccggcatggagtccgactacgccgcggcaggcatcggacac
ttcatggtcgacgggccctcgctgcacggggacaccgcactcggccggccggtggccggc
tccgacgtcgtggcgttcggccgcgatcttcaggtcagctaccgcgtctggtccccgagg
tccggctatcccggccacgccgcctaccgcgacttccacacctacgaccacgccaccggc
ctcaaaccggctcgcgtcacgggtcgcaacgtaccctccgacgccaaagcgccctacgac
cccgagcgcgccgacgccgccgtggacgcccacgtcgccgatttcgtcgacacggtccgg
cagcgcctgagcacggagagcgcgcggatcggccgcccggcccatgtgatcgccgccttc
gacaccgagttgttcgggcactggtggtacgaggggccggtgtggctggagcgggtgttg
cgcgcacttcccgccgccggcatccgggtcggcacgctgtccgacgcggtggccggcgga
tacgtggggacccctgtcgaattgccgcccagctcatggggttccggtaaggactggcag
gtctgggccggagagaaggtcgccgatctggtgcagctcaacaccgaggtcgtcgacgcc
gcgctgagtaccgtcgacaaggcgctcgccgaaccggcggcagtgggtgcaccgacgccg
agaagctttgtcgccgatcagatcctgcgcgagacactgctcaccgtgtcgagcgactgg
ccgttcatggtgagcaaggactcggctgccgactatgcgcgctaccgtgcgcacctgcac
gcgcacgccacccgcgagatcgccggcgcgctggcctccggccggaccgagcaggcgcag
cggctggctgagggctggaaccgcgccgacggactgttcggagccctcgacgcccggagg
ctgccgagcccgtga

DBGET integrated database retrieval system