KEGG   Mycobacterium chubuense: Mycch_1833Help
Entry
Mycch_1833        CDS       T02150                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00010  Glycolysis / Gluconeogenesis
mcb00030  Pentose phosphate pathway
mcb00051  Fructose and mannose metabolism
mcb00052  Galactose metabolism
mcb00680  Methane metabolism
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_1833
   00030 Pentose phosphate pathway
    Mycch_1833
   00051 Fructose and mannose metabolism
    Mycch_1833
   00052 Galactose metabolism
    Mycch_1833
  Energy metabolism
   00680 Methane metabolism
    Mycch_1833
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mycch_1833
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Mycch_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: AFM16623
UniProt: I4BH66
Position
1903594..1904625
Genome map
AA seq 343 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRTCDVRYGSSVVGFQDGWRGLLEDRRVQLRNDDRNDR
LLAKGGTMLGTARVNPDKLRAGLDQIKQTLEDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDVEDVCRLVKQRFVRGDSHFICVVAEGAKPAEGSMQLREGGID
EFGHERFTGVAQQLAIEVEKRINKEVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGMMVSLRGQEIGRVPLADAVRQLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggaatactgaccggcggtggtgactgtccaggcctgaacgcggtgatccgc
gccgtcgtccgcacctgcgacgtgcgatacggatcgtcggtggtgggcttccaggacggc
tggcgcggcctgctcgaggaccgccgcgtgcagctgcgcaacgacgatcgcaacgaccgg
ctcttggccaagggcggcacgatgctcggcacggcgcgcgtcaacccggacaagctgcgc
gccggactggaccagatcaaacagacgctcgaggacaacggcatcgacgtgctcatcccg
atcgggggcgagggcaccctgaccgcggcgcactggctctccgaggagaacgttcccgtc
gtcggcgtacccaaaacgatcgacaacgacatcgactgcaccgacgtcactttcggccac
gacactgccctgaccgtggccaccgaggcgatcgaccggctgcacagcaccgccgaatcg
catcagcgcgtgatgctcgtcgaggtgatgggccgccacgcggggtggatcgcgctgaac
gccggcctggcctcgggagcgcacatgacgctgatccccgagcagccgttcgacgtcgag
gatgtctgccgattggtcaaacagcgcttcgtgcgcggggattcacacttcatctgtgtg
gtggccgaaggcgccaagccggccgaggggtcgatgcagctgcgcgagggcggcatcgac
gagttcggtcacgagcgcttcaccggcgtggcgcagcagctcgccatcgaggtcgagaag
cggatcaataaggaagtccgggtgacggtgctcggtcacgtgcagcgcggtggtacgccg
accgcctacgaccgcgtgctggccacccgcttcggggtgaacgccgccgacgcagcccac
gccggcgagtacgggatgatggtgtcgctgcgcgggcaggagatcgggcgggtgccgctg
gccgacgcggtccgtcaactcaagctggtgccgcagagccgctacgacgacgccgcggag
ttcttcggctga

DBGET integrated database retrieval system