KEGG   Mycobacterium chubuense: Mycch_1833Help
Entry
Mycch_1833        CDS       T02150                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_1833
   01230 Biosynthesis of amino acids
    Mycch_1833
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_1833
   00030 Pentose phosphate pathway
    Mycch_1833
   00051 Fructose and mannose metabolism
    Mycch_1833
   00052 Galactose metabolism
    Mycch_1833
  Energy metabolism
   00680 Methane metabolism
    Mycch_1833
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mycch_1833
Protein phosphatases and associated proteins [BR:mcb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mycch_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1903594..1904625
Genome map
AA seq 343 aa AA seqDB search
MRIGILTGGGDCPGLNAVIRAVVRTCDVRYGSSVVGFQDGWRGLLEDRRVQLRNDDRNDR
LLAKGGTMLGTARVNPDKLRAGLDQIKQTLEDNGIDVLIPIGGEGTLTAAHWLSEENVPV
VGVPKTIDNDIDCTDVTFGHDTALTVATEAIDRLHSTAESHQRVMLVEVMGRHAGWIALN
AGLASGAHMTLIPEQPFDVEDVCRLVKQRFVRGDSHFICVVAEGAKPAEGSMQLREGGID
EFGHERFTGVAQQLAIEVEKRINKEVRVTVLGHVQRGGTPTAYDRVLATRFGVNAADAAH
AGEYGMMVSLRGQEIGRVPLADAVRQLKLVPQSRYDDAAEFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggaatactgaccggcggtggtgactgtccaggcctgaacgcggtgatccgc
gccgtcgtccgcacctgcgacgtgcgatacggatcgtcggtggtgggcttccaggacggc
tggcgcggcctgctcgaggaccgccgcgtgcagctgcgcaacgacgatcgcaacgaccgg
ctcttggccaagggcggcacgatgctcggcacggcgcgcgtcaacccggacaagctgcgc
gccggactggaccagatcaaacagacgctcgaggacaacggcatcgacgtgctcatcccg
atcgggggcgagggcaccctgaccgcggcgcactggctctccgaggagaacgttcccgtc
gtcggcgtacccaaaacgatcgacaacgacatcgactgcaccgacgtcactttcggccac
gacactgccctgaccgtggccaccgaggcgatcgaccggctgcacagcaccgccgaatcg
catcagcgcgtgatgctcgtcgaggtgatgggccgccacgcggggtggatcgcgctgaac
gccggcctggcctcgggagcgcacatgacgctgatccccgagcagccgttcgacgtcgag
gatgtctgccgattggtcaaacagcgcttcgtgcgcggggattcacacttcatctgtgtg
gtggccgaaggcgccaagccggccgaggggtcgatgcagctgcgcgagggcggcatcgac
gagttcggtcacgagcgcttcaccggcgtggcgcagcagctcgccatcgaggtcgagaag
cggatcaataaggaagtccgggtgacggtgctcggtcacgtgcagcgcggtggtacgccg
accgcctacgaccgcgtgctggccacccgcttcggggtgaacgccgccgacgcagcccac
gccggcgagtacgggatgatggtgtcgctgcgcgggcaggagatcgggcgggtgccgctg
gccgacgcggtccgtcaactcaagctggtgccgcagagccgctacgacgacgccgcggag
ttcttcggctga

DBGET integrated database retrieval system