KEGG   Mycobacterium chubuense: Mycch_1898Help
Entry
Mycch_1898        CDS       T02150                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mcb  Mycobacterium chubuense
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mcb03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1968457..1969308
Genome map
AA seq 283 aa AA seqDB search
MPELPEVEVVRRGLNEHVTGKTITAVRVHHPRAVRRHEAGPADLAARLLDATVTGTGRRG
KYLWLTLADGGALVVHLGMSGQMLLGPVPNENHLRIAALLDDGTTLSFVDQRTFGGWLIA
DLVTVDGTDVPAPVAHIARDPLDPQFDRDRVVNVLRGKHSEIKRQLLDQTVVSGIGNIYA
DEALWRAKVNGARLASGLSRPKLAELLDAAAVVMTDALGQGGTSFDSLYVNVNGESGYFD
RSLDVYGREGEPCRRCGAVMRREKFMNRSSFYCPRCQPRPRVR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaactgcctgaagtcgaggtggtccggcggggattgaacgagcacgtcacaggt
aagaccatcacggccgtccgggtccaccatccgcgcgccgtgcgccgtcacgaggccgga
cccgcggacctggccgcgcgcctgctcgacgcgacggtcaccggcacgggccggcgcggc
aagtacctgtggctgacgctggccgacggcggcgcgctcgtcgtgcacctcgggatgagc
gggcagatgctgctgggtcccgtgcccaacgagaaccatctgcgcatcgcggcgctgctc
gacgacggcacgacgctgagcttcgtcgaccagcgcaccttcggcgggtggctgatcgcc
gacctcgtgaccgtcgacggcaccgacgtgcctgcgccggtcgcgcacatcgcccgggat
ccgctggacccgcagttcgatcgcgatcgcgtggtgaacgtgttgcgcggcaagcattcc
gagatcaaacgccaactgctcgaccagaccgtggtgtccggcatcgggaacatctacgcc
gacgaggcgctgtggcgtgcgaaggtcaacggggcgcggctggcgtcggggctgtcgcgg
ccgaagctcgccgagttgctcgacgcggccgccgtggtgatgaccgatgcgctgggccag
ggcgggacgtcgttcgattcgctctatgtcaacgtcaacggcgagtccggctacttcgac
cggtcgctggacgtctacggccgcgagggcgagccgtgccggcgctgcggcgcggtgatg
cggcgcgagaagttcatgaaccgctcgtcgttctactgcccccgctgccagccacgtccc
cgcgtgcgctga

DBGET integrated database retrieval system