KEGG   Mycobacterium chubuense: Mycch_2036Help
Entry
Mycch_2036        CDS       T02150                                 

Definition
Mg-chelatase subunit ChlI (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mcb  Mycobacterium chubuense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mycch_2036
Enzymes [BR:mcb01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mycch_2036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2112243..2114132
Genome map
AA seq 629 aa AA seqDB search
MTAVGSAEALYPFSALVGHDRLRLALLLCAVRPDIGGVLIRGEKGTAKSTAVRGLAHVLS
EAFRASGDDGGQLVELPIGATEDRVVGSLDLQKVLRDGEHAFSPGLLARAHRGVLYVDEV
NLLHDHLVDVLLDAAAMGRVHIERDGVSHSHEARFVLIGTMNPEEGELRPQLLDRFGLTV
DVAASRDVDVRAEVIRQRLAFEADPAAFAQRYAEADAQVAARIAEARALLPDVVLPDKEL
RRIAALCAAFDVDGMRADLVVARTAVAHAAWRGSLTVEEDDIRVAAELALPHRRRRDPFD
DPGLDPDRLDDAMQQAGESAENSPEPEPEPDPPGGGQSSSDELADNAVPQRNSPPPSRPS
APPAQPFRTRALVVPGVGEGAPGRRSRARNRTGTVVSATADTASGHGLHVFATLLAAAGR
QADAGRVRPAPDDVRRAIREGREGNLVVFVVDASGSMAARDRMSAVSGATLSLLRDAYQR
RDKVAVITFRGQDARVLLPPTSSVYIASRRLTRFDTGGRTPLAQGLLAARDMVVRERTRD
RARRSLVVVLTDGRATGGPDALGRTRVAAARLVAEGVAAVVVDCETSYVRLGLADDLARH
LNAPSVRLDALRAEQLTALVKVQADRGAA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcggtgggttccgccgaggcgctctaccccttcagcgcgctggtgggccacgac
cggctgcgactggcgctgctgctgtgcgcggtgcggcccgacatcggcggcgtgctcatc
cgcggcgagaagggcaccgccaagtccaccgccgtgcgcggtctcgcccacgtgctctcc
gaggccttcagggcatccggcgatgacggcggccagctggtggaactgccgatcggcgcc
accgaggaccgggtggtcggatcgctggacctgcagaaggtgctgcgcgacggcgagcac
gccttctcaccgggcctgctcgcccgtgcgcaccgcggcgtgctgtacgtcgacgaggtg
aacctgctgcacgaccacctggtcgacgtgctgctggacgccgcggccatgggccgcgtg
cacatcgaacgcgacggcgtctcccacagccacgaggcgcgattcgtgctgatcggcacg
atgaatcccgaggagggggagttgcggccgcagctcctcgaccggttcggcctcaccgtc
gacgtcgcggcctcccgcgacgtcgacgtccgcgccgaggtgatccgccagcgcctggcc
ttcgaagccgaccccgccgccttcgcgcagcgctacgccgaggcggacgcacaggtggcc
gcccgcatcgccgaagcgcgcgctctgctccccgatgtggtgctgccggacaaggagtta
cgccggatcgcggcgctgtgcgccgcgttcgacgtcgacgggatgcgggcggacctggtg
gtcgcgcgaaccgcggtggcgcacgcggcgtggcggggatcgctgaccgtcgaagaagac
gacatccgtgtcgcggccgaactcgcactgccgcaccggcgccgtcgcgacccgttcgac
gaccccggtctggatcccgaccggctcgacgacgccatgcagcaggccggcgagtccgcc
gagaacagccccgagccggagccggagcccgatccgccgggcggtggccagtcgtcatcc
gacgagctcgccgacaacgctgtcccgcaacggaattcgccgccgccgagccggcccagc
gccccgccggcgcagcccttccggaccagggcgctggtcgttcccggtgtcggggagggt
gcgcccggacgccgctcgcgggcacgcaaccgcaccggcacggtcgtctcggccaccgcc
gacaccgcctccggccacggcctccacgtgttcgcgacgctgctggccgcggccggacgg
caggctgatgcgggccgggtgcggccggcccccgacgacgttcgccgggcgattcgcgaa
gggcgcgagggaaatctggtcgtcttcgtcgtcgacgcctcgggttcgatggccgcccgc
gaccggatgtcggcggtcagcggggcgacgctgtcgctgctgcgagacgcctaccagcgc
cgggacaaggtcgcggtgatcacgttccgcggccaggacgcgagggtgctgctgccgccg
acgtcgtcggtgtacatcgcgagccgccggctgacgcggttcgacaccgggggcaggacc
ccgctggcacagggcctgctggcggcccgcgacatggtcgtgcgggaacgcacccgcgac
cgcgcccgccgcagcctggtggtggtgctcaccgacgggcgcgcgaccggcggacccgac
gcgctcggacggacccgcgtcgccgccgcccggctggtggccgaaggcgtcgccgcggta
gtcgtcgactgcgaaacctcctatgtgcgcctgggtttggccgacgatctggctcggcac
ctgaatgccccctcggtccggctggatgcactgcgcgccgagcagctgaccgcgctggtc
aaggtccaggcggaccgcggcgcggcctga

DBGET integrated database retrieval system