KEGG   Mycobacterium chubuense: Mycch_2082Help
Entry
Mycch_2082        CDS       T02150                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mcb  Mycobacterium chubuense
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mcb00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mcb00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2155831..2156325
Genome map
AA seq 164 aa AA seqDB search
MSLTQRQLNLIWAQSSSGVIGRGNGIPWQVPEDMARFKELTMGHTVIMGRRTWESLPEKF
RPLPGRRNVVVTRQADYMADGAEVVASLEEAPDGDAWVIGGSQIYRLAMPLATRCEVTEV
DVDLRREDDDALAPVLDESWVGTEGEWRDSRSGLRYRFYSYLRT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcacgcagcgtcaactgaatctgatctgggcgcagtcctcctcgggcgtcatc
ggacgcggcaacggcattccctggcaggtgcccgaggacatggcccgcttcaaggaactc
acgatgggccacaccgtgatcatgggccgaaggacctgggagtcgctgcccgagaagttc
cggccgctgccgggccgcagaaatgtcgtagtgacccggcaagctgactacatggcggac
ggggcggaagtggtcgcctccctggaggaggcgccggacggcgacgcgtgggtgatcggc
ggctcgcagatctaccggctggcgatgccgctggccacgcggtgcgaggtgaccgaggtc
gacgtcgacctgcgcagggaggacgacgacgcgctggcgcccgttctcgacgagtcatgg
gtcggcaccgagggcgagtggcgggacagtaggtcggggctgcgctaccggttctacagc
tacctgaggacatga

DBGET integrated database retrieval system