KEGG   Mycobacterium chubuense: Mycch_2082Help
Entry
Mycch_2082        CDS       T02150                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mcb  Mycobacterium chubuense
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mycch_2082
   00670 One carbon pool by folate
    Mycch_2082
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mycch_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2155831..2156325
Genome map
AA seq 164 aa AA seqDB search
MSLTQRQLNLIWAQSSSGVIGRGNGIPWQVPEDMARFKELTMGHTVIMGRRTWESLPEKF
RPLPGRRNVVVTRQADYMADGAEVVASLEEAPDGDAWVIGGSQIYRLAMPLATRCEVTEV
DVDLRREDDDALAPVLDESWVGTEGEWRDSRSGLRYRFYSYLRT
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcacgcagcgtcaactgaatctgatctgggcgcagtcctcctcgggcgtcatc
ggacgcggcaacggcattccctggcaggtgcccgaggacatggcccgcttcaaggaactc
acgatgggccacaccgtgatcatgggccgaaggacctgggagtcgctgcccgagaagttc
cggccgctgccgggccgcagaaatgtcgtagtgacccggcaagctgactacatggcggac
ggggcggaagtggtcgcctccctggaggaggcgccggacggcgacgcgtgggtgatcggc
ggctcgcagatctaccggctggcgatgccgctggccacgcggtgcgaggtgaccgaggtc
gacgtcgacctgcgcagggaggacgacgacgcgctggcgcccgttctcgacgagtcatgg
gtcggcaccgagggcgagtggcgggacagtaggtcggggctgcgctaccggttctacagc
tacctgaggacatga

DBGET integrated database retrieval system