KEGG   Mycobacterium chubuense: Mycch_2181Help
Entry
Mycch_2181        CDS       T02150                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mcb  Mycobacterium chubuense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mycch_2181
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Mycch_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2248097..2249443
Genome map
AA seq 448 aa AA seqDB search
MTTSYCIVGGGISGLVAAYRLRVAAGPDVSITVLDPADRLGGVLRTERVGGQPLDVGAEA
FVARRPEVPALLGELGLSGKQIATTGARPLIYSEGRLHQLPRDTVNGIPSRAGALTGLVD
DATIRWMLDEPRRPLSWRPGADPSVAELVGDRFGEQVVARSVDPLLAGVYAGSAATIGMR
AAAPTVATALDRGARSLTEAVNSVLPPPVSGSIFGAIDGGYAVLIDELVRRSALTWAQVT
VRGVHQTARGWELLDDEGTRWSADAVVLAVPAPRLPALISDVAPASAAAARKIPVASSAV
VALALPGGTPLPEQSGVLVAGRGRLRAKAVTLSSRKWGRRGSVEMVRLSFGRFGDDLARR
AGDEELLTWSAEDLGTLFGISVEPVDSRVARWLDAMPQYGPGHGDLIAELRTGLPPRLAV
AGAYLDGIGVPACVAAATRAAAALTVQT
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacttcctattgcattgtcggcggcggtatttcgggtctggtcgccgcgtaccgg
ttgcgcgtggcagccggccccgacgtgtcgatcacggtgctcgacccggccgaccgcctc
ggcggcgtcctgcgcaccgagcgggtcggcgggcagccgctcgacgtcggtgccgaggcc
ttcgtggcccgcaggcccgaggtgcccgcactactcggcgagctgggcctctccggaaag
cagatcgccaccaccggcgcccgcccgctgatctacagcgaaggccggctgcaccagctg
ccccgcgacaccgtcaacggcattccgtcgcgggccggcgcgctgacggggctggtcgac
gacgcgacgatccggtggatgctcgacgagccccggcggccgctgtcctggcgccccggc
gcggatccgtcggtcgccgaactcgtcggcgaccggttcggcgaacaggtcgtcgcccgc
tcggtcgacccgttgctcgccggtgtgtacgccggttcggccgcgacgatcggcatgcgt
gcggccgcaccgacggtggccacggcgctggatcgcggtgcccgcagcctcacggaggcg
gtcaattcggtcctgcccccgcccgtgtccggatcgatcttcggcgcgatcgacggcggc
tacgccgtgttgatcgacgaactggtacgtcgctccgcgctgacgtgggcacaggtgacc
gtgcgcggcgttcatcagacggcgcgcgggtgggaactcctcgacgacgaaggcacccgg
tggtccgccgacgccgtcgtgctggcggtccccgcgccgcgactgccggcgctgatctcc
gacgtcgccccggccagcgcggccgccgcccgcaagatcccggtcgcctcgtccgcggtc
gtcgcgctggcactgccgggcggcacgccgctgcccgagcagtccggcgtgctcgtcgcc
ggtcgcgggaggctgcgcgcgaaggcggtcaccctgtcgtcgcggaagtgggggcgccgc
ggcagcgtcgagatggtgcggctgtcgttcggccggttcggcgacgacctggcgcgccgc
gccggcgatgaggagttgctgacctggtcggctgaggacctcggcacgttgttcggtatc
tcggtggaaccggtcgattcccgggtggcccgctggctggatgcgatgccgcagtacggg
ccgggccacggcgacctgatcgccgaattgcgcacggggcttccgccgcggctggccgtg
gccggtgcctatctcgacggcatcggggtgcccgcctgcgtggcggcggcgacccgggct
gcggcggcgctgaccgtccagacctga

DBGET integrated database retrieval system