KEGG   Mycobacterium chubuense: Mycch_2303Help
Entry
Mycch_2303        CDS       T02150                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mcb  Mycobacterium chubuense
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mycch_2303
Enzymes [BR:mcb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mycch_2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2359598..2360185
Genome map
AA seq 195 aa AA seqDB search
MIAAVRGEVLDIALDHVVIEAAGVGYKVMATPATLATLRRGSEARLITAMIVREDSMTLY
GFADSDARDLFLTLLGVSGIGPSIALGALAMYDGPTLRQAIGDGDVTALTRIPKVGKKTA
ELLVLTLRDKVGTPTSAGVTSAAGHVVRGPVVEALVGLGFALKQAEEATDKVLADDPNAS
QSAALRAALSMLGKK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccgccgtgcggggtgaggtcctcgacatcgctctcgaccatgtggtcatcgag
gcggccggcgtcggctacaaggtgatggcgactccggcgacgctggccaccctgcgccgc
ggcagcgaggcccggttgatcaccgcgatgatcgtgcgcgaggactcgatgacgctgtac
ggcttcgccgactccgacgcccgcgacctgttcctgaccctgctcggcgtgtccggcatc
gggcccagcatcgcgctcggggcgctggcgatgtacgacggccccacgctgcggcaggcg
atcggcgacggagacgtcaccgcgctgacccgcatccccaaggtcggcaagaagaccgcc
gaactgctggtgctgacgctgcgcgacaaggtcggcacgcccacgtcggccggggtgacc
tcagctgcgggccatgtcgtgcgcggcccggtcgtcgaagcgctcgtcggcctcgggttc
gcgctcaagcaggccgaagaggccaccgacaaggttctcgccgacgatccgaacgccagc
cagtcggccgccctgcgcgcggcgctgtcgatgctggggaagaagtga

DBGET integrated database retrieval system