KEGG   Mycobacterium chubuense: Mycch_2402Help
Entry
Mycch_2402        CDS       T02150                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mcb  Mycobacterium chubuense
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mycch_2402
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mycch_2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2474219..2474827
Genome map
AA seq 202 aa AA seqDB search
MSEGGGPDSVTAPVVVLSGPSAVGKSTVVRCLRERVPDLYFSVSVTTRAPRPGEIDGVDY
SFVTAEQFQRLIDDGALLEWAEIHGGLHRSGTPAGPVRTAAAAGHPVLIEVDLAGARAVK
KAMPEATTVFLAPPSWDVLESRLSGRGTETADVMARRLQTARAELAAQGDFDQVVVNSQL
ESACAELVSLLVARTPVPRDQV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaaggcggtgggccggacagcgtcacggcacctgtcgtagtgctgtccggcccg
tctgccgtcgggaagtccaccgtggtccggtgcctgcgcgagcgtgtccccgatctgtac
ttcagcgtctcggtgaccacccgagcgccgcgcccgggggagatcgacggcgtggactac
tcgttcgtgacggcggaacaatttcagcggctcatcgacgacggcgccctgctggagtgg
gccgagatccacggcggcctgcaccggtcgggaacgcccgcgggtcccgtccggacagct
gcggcggcgggtcaccccgtcctcatcgaggtggatctcgccggcgcccgggccgtcaag
aaggccatgcccgaggcgaccaccgtgttcctcgcaccgcccagctgggacgtgctggag
agccggttgtccggccgcggcaccgagactgccgacgtgatggcccgcaggctgcagacc
gcccgggcggaattggccgcgcaaggggacttcgaccaggtcgtcgtcaacagccaattg
gaatcggcctgcgccgaattggtatccttgctggtggcccgcacaccggtgccgcgcgat
caggtctga

DBGET integrated database retrieval system