KEGG   Mycobacterium chubuense: Mycch_2430Help
Entry
Mycch_2430        CDS       T02150                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_2430
   01230 Biosynthesis of amino acids
    Mycch_2430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_2430
   00051 Fructose and mannose metabolism
    Mycch_2430
   00562 Inositol phosphate metabolism
    Mycch_2430
Enzymes [BR:mcb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mycch_2430
Exosome [BR:mcb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mycch_2430
  Exosomal proteins of bladder cancer cells
   Mycch_2430
  Exosomal proteins of melanoma cells
   Mycch_2430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2502583..2503368
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFSLPDKYFDKVDVTVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSQHDSGAYTGEISGAFLAKLGCSFVVVGHSERRTYHGEDDALVAAKAAA
AFKHGLTPIICIGEHLDVREAGNHVDYNVTQLRGSLAGLSADQIGRAVIAYEPVWAIGTG
RVAGAADAQEVCKAIRDELGNLASPELAAGVRVLYGGSVNAKNVGEIVGQGDVDGALVGG
ASLDAEQFATLSAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtaagccgttgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcagaagatcgcgttctcgttgccggataagtacttcgacaaggtcgat
gtcaccgtcatcccgccgttcaccgacctgcgcagcgtgcagacgctcgtcgacggcgac
aagctgcggctcacctacggcgcgcaggatctctcgcagcacgactccggcgcgtacacc
ggcgagatcagcggcgcgttcctggcgaagctgggctgctcgtttgtcgtcgtcgggcac
tcggagcggcgcacgtaccacggcgaggacgacgcgctggtcgccgcgaaggcggccgcg
gcgttcaagcacggactgacgccgatcatctgcatcggcgaacacctcgacgtccgtgag
gccggcaaccacgtcgactacaacgtcacgcaactgcgcggctcgctggccgggctctcc
gccgaccagatcggccgggccgtgatcgcctacgagccggtgtgggcgatcggtaccggc
cgggtcgccggcgccgcggatgcgcaggaagtgtgcaaggcgatccgcgacgaactcgga
aacctcgcgtccccggagctcgcggcgggcgtgcgcgtgctctacggcggctcggtgaac
gccaagaacgtcggcgagatcgtcggacagggcgacgtcgacggcgccctggtcggcggc
gcatccctggacgccgagcagttcgcgacgctgtcggccatcgccgcgggcgggccgctt
ccgtga

DBGET integrated database retrieval system