KEGG   Mycobacterium chubuense: Mycch_2538Help
Entry
Mycch_2538        CDS       T02150                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mcb  Mycobacterium chubuense
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycch_2538
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mycch_2538
Enzymes [BR:mcb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mycch_2538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2617987..2618805
Genome map
AA seq 272 aa AA seqDB search
MSSATVLDSILEGVRADVAAREAVVSLAEVKEQARRAPAPLDVMAALRAPGIAVIAEVKR
ASPSRGALASIADPAHLASAYEDGGARVISVLTEQRRFHGSLDDLDAVRAAVSIPVLRKD
FIIWPYQIHEARAHGADMLLLIVAALEQPVLVSLLERTESLGMTALVEVHTEQEADRALQ
AGASVIGVNARDLKTLEVDRDCFARIAPGLPSNVIRIAESGVRGTADLLAYAGAGADAVL
VGEGLVTSGDPRSAVADLVTAGRHPSCPKPAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcgaccgtgctcgactccattctcgaaggagtccgcgccgacgttgccgcc
cgtgaggccgtcgtcagcctggccgaggtcaaggagcaggctcggcgcgcacccgcaccg
ctcgacgtgatggccgcgctgcgtgcaccgggcatcgcggtgatcgccgaggtgaagcgc
gccagcccgtcgcggggcgcgctggcctcgatcgccgacccggcccacctcgccagtgcc
tacgaagacggcggggcgagggtcatcagcgtgctcaccgagcagcgccggttccacggc
tcgctcgacgacctggacgcggtgcgtgccgcggtgtcgattcccgtgttgcgcaaggat
ttcatcatctggccctaccagatccacgaggcccgcgcgcacggcgccgacatgcttctg
ctgatcgtcgcggcgttggagcagccggtgctggtgtcgctgctcgagcgcaccgagtcg
ctgggcatgaccgcgctcgtcgaggtgcacaccgagcaggaggccgaccgggcgctgcag
gccggcgcgtcggtgatcggtgtgaacgcccgcgacctcaagacgctcgaagtcgaccgc
gactgcttcgccaggatcgccccgggcctgcccagcaacgtcatccggatcgctgagtcc
ggtgttcggggcaccgccgacctcttggcctacgcgggtgcgggcgccgacgccgtcctc
gtcggcgagggtctggtcaccagcggtgacccccgcagcgccgtcgcagacctcgtgacc
gccggcaggcatccgtcgtgcccgaagcccgctcgttaa

DBGET integrated database retrieval system