KEGG   Mycobacterium chubuense: Mycch_2539Help
Entry
Mycch_2539        CDS       T02150                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00260  Glycine, serine and threonine metabolism
mcb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01130  Biosynthesis of antibiotics
mcb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycch_2539
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mycch_2539
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mycch_2539
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2 AAA_5
Motif
Other DBs
NCBI-ProteinID: AFM17312
UniProt: I4BJ55
Position
2618806..2620068
Genome map
AA seq 420 aa AA seqDB search
MVNSVGPDLPRASAAVAEPTGHDPDARGHFGVYGGRYVPEALMAVIEEVTAAYEKARGDQ
AFLDELDRLQRHYTGRPSPVYEAERLSVHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGATVVP
VESGSKTLKDAINETFRDWVAHADNTYYCFGTAAGPHPFPMMVRDFQRVIGLEARAQMLD
QAGRLPDAVVACVGGGSNAIGIFHAFIDDPGVRLVGYEAAGDGVETGRHAATFTGGSPGA
FQGSYSYVLQDEDGQAIESHSISAGLDYPGVGPEHALLKDIGRARYEPITDTEAMDALSL
LSRTEGIIPAIESAHAVAGALKLGVELGPGAIILVNVSGRGDKDVETAAKWFGLLDGGKP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaattcagtcggtcctgacctaccgcgcgccagtgctgcggtagccgaacccacc
ggacacgaccccgacgcacgggggcatttcggcgtgtatgggggcaggtacgtccccgag
gcgctgatggccgtcatcgaggaggtgacggccgcctacgagaaggcgcgcggcgatcag
gccttcctcgacgagctcgaccggctgcagcgccactacaccgggcgtccgtcgccggtg
tacgaggcggagcggctgagcgtgcacgcgggcggcgcacgaatctttctcaaacgagaa
gacctgaaccacacggggtctcacaagatcaacaacgtcctcggccaggccctgctcgcc
cggcagatgggcaagacgcgggtgatcgccgaaaccggcgccggacagcacggggtggcg
acagcgaccgcatgcgcgttgctcggcctggagtgcgtcatctacatgggtgcggtcgac
accgcgcgccaggccctcaacgtggcgcggatgcggctgctcggggcgacggtggtgccg
gtcgagtcaggctcgaagacgctcaaagatgcgatcaacgagacgttccgggattgggtg
gcccacgcggacaacacctactactgcttcggcaccgcggccggtccgcacccgttcccg
atgatggtgcgcgacttccagcgggtgatcgggctcgaggcgcgcgctcagatgctggat
caggccggccggctgcccgacgccgtggtcgcctgcgtcggcggcggatcgaacgcgatc
ggcatcttccacgcgttcatcgacgacccgggcgtgcggctggtcggctacgaggcagcg
ggtgacggcgtcgaaaccggccgccacgcagcgacgttcaccggagggtcgccgggcgcc
ttccaggggtcctactcgtacgtgctgcaggacgaagacgggcaggccatcgaatcccat
tccatttccgcaggattggactatccgggtgtcgggcctgagcacgcgctgctcaaagac
atcggccgggcacggtatgagccgatcaccgacaccgaggcgatggacgcgctgtcgctg
ctgagccgcaccgaggggatcatcccggccatcgagtctgcacacgccgtggcgggcgcg
ctgaaactcggcgtcgaactcggacccggggcgatcatcctggtcaacgtctccggtcga
ggggacaaggacgtcgaaacagctgccaagtggttcgggctgctggacggagggaagcca
tga

DBGET integrated database retrieval system