KEGG   Mycobacterium chubuense: Mycch_2539Help
Entry
Mycch_2539        CDS       T02150                                 

Definition
tryptophan synthase, beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mcb00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mcb00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2618806..2620068
Genome map
AA seq 420 aa AA seqDB search
MVNSVGPDLPRASAAVAEPTGHDPDARGHFGVYGGRYVPEALMAVIEEVTAAYEKARGDQ
AFLDELDRLQRHYTGRPSPVYEAERLSVHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGATVVP
VESGSKTLKDAINETFRDWVAHADNTYYCFGTAAGPHPFPMMVRDFQRVIGLEARAQMLD
QAGRLPDAVVACVGGGSNAIGIFHAFIDDPGVRLVGYEAAGDGVETGRHAATFTGGSPGA
FQGSYSYVLQDEDGQAIESHSISAGLDYPGVGPEHALLKDIGRARYEPITDTEAMDALSL
LSRTEGIIPAIESAHAVAGALKLGVELGPGAIILVNVSGRGDKDVETAAKWFGLLDGGKP
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggtcaattcagtcggtcctgacctaccgcgcgccagtgctgcggtagccgaacccacc
ggacacgaccccgacgcacgggggcatttcggcgtgtatgggggcaggtacgtccccgag
gcgctgatggccgtcatcgaggaggtgacggccgcctacgagaaggcgcgcggcgatcag
gccttcctcgacgagctcgaccggctgcagcgccactacaccgggcgtccgtcgccggtg
tacgaggcggagcggctgagcgtgcacgcgggcggcgcacgaatctttctcaaacgagaa
gacctgaaccacacggggtctcacaagatcaacaacgtcctcggccaggccctgctcgcc
cggcagatgggcaagacgcgggtgatcgccgaaaccggcgccggacagcacggggtggcg
acagcgaccgcatgcgcgttgctcggcctggagtgcgtcatctacatgggtgcggtcgac
accgcgcgccaggccctcaacgtggcgcggatgcggctgctcggggcgacggtggtgccg
gtcgagtcaggctcgaagacgctcaaagatgcgatcaacgagacgttccgggattgggtg
gcccacgcggacaacacctactactgcttcggcaccgcggccggtccgcacccgttcccg
atgatggtgcgcgacttccagcgggtgatcgggctcgaggcgcgcgctcagatgctggat
caggccggccggctgcccgacgccgtggtcgcctgcgtcggcggcggatcgaacgcgatc
ggcatcttccacgcgttcatcgacgacccgggcgtgcggctggtcggctacgaggcagcg
ggtgacggcgtcgaaaccggccgccacgcagcgacgttcaccggagggtcgccgggcgcc
ttccaggggtcctactcgtacgtgctgcaggacgaagacgggcaggccatcgaatcccat
tccatttccgcaggattggactatccgggtgtcgggcctgagcacgcgctgctcaaagac
atcggccgggcacggtatgagccgatcaccgacaccgaggcgatggacgcgctgtcgctg
ctgagccgcaccgaggggatcatcccggccatcgagtctgcacacgccgtggcgggcgcg
ctgaaactcggcgtcgaactcggacccggggcgatcatcctggtcaacgtctccggtcga
ggggacaaggacgtcgaaacagctgccaagtggttcgggctgctggacggagggaagcca
tga

DBGET integrated database retrieval system