KEGG   Mycobacterium chubuense: Mycch_2540Help
Entry
Mycch_2540        CDS       T02150                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycch_2540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycch_2540
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mycch_2540
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mycch_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2620065..2620853
Genome map
AA seq 262 aa AA seqDB search
MSRLAGVFQSCHDEGRSALIGYLPTGFPDVPQSISAMTALVEAGCDVIEVGIAYSDPGMD
GPTIAAATEVALRGGVKVRDAFTAVEAISNAGGRAVVMTYWNPVLSKGVDTFARDLASAG
GLGLITPDLIPDEADEWLAASEAHDLDRIFLVAPSSTPERLAATVHASRGFVYAASTMGV
TGARDAVSNAAPELVRRVKEVSDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALTD
GIPAMRSLTEELAEGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctcgcgggcgtcttccagtcctgccatgacgagggccgttccgcgctcatt
ggctacctgcccaccggtttccctgatgtgccgcagtcgatttcggcgatgacggctttg
gtcgaggcaggctgcgacgtcatcgaggtcggcatcgcctattccgatcctggaatggac
ggccccaccatcgcagcggcgaccgaggtcgcgctgcgcgggggagtcaaggtgcgcgat
gcgttcaccgcggtcgaggccatcagcaacgccggcgggcgggcggtcgtgatgacctac
tggaatcccgtgctgagcaagggcgtcgacaccttcgctcgcgatctggcgtcggccggc
ggcctcggactgatcactccggacctgatcccggacgaggccgacgaatggctggccgcc
tccgaggcgcacgacttggacaggatcttcctcgtcgctccgtcgtcgacccccgaacga
ctggctgcgacggtgcacgcgtcgagaggattcgtgtacgcggcatcgacgatgggcgtc
accggtgcccgcgacgcggtctcgaacgcggcgccggaactggtgcgccgggtcaaagaa
gtatcggacatccccgtcggtgtcgggctcggcgtgcgctcgcgggagcaggccgcggag
atcggcgcctacgccgatggcgtcatcgtcggttctgcgctggtctctgcgctcaccgac
ggcattccggcgatgaggtcgttgaccgaggaactggcagagggcgtgcggcagaggatc
actgcgtga

DBGET integrated database retrieval system