KEGG   Mycobacterium chubuense: Mycch_2540Help
Entry
Mycch_2540        CDS       T02150                                 

Definition
tryptophan synthase, alpha chain (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycch_2540
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycch_2540
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mycch_2540
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mycch_2540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2620065..2620853
Genome map
AA seq 262 aa AA seqDB search
MSRLAGVFQSCHDEGRSALIGYLPTGFPDVPQSISAMTALVEAGCDVIEVGIAYSDPGMD
GPTIAAATEVALRGGVKVRDAFTAVEAISNAGGRAVVMTYWNPVLSKGVDTFARDLASAG
GLGLITPDLIPDEADEWLAASEAHDLDRIFLVAPSSTPERLAATVHASRGFVYAASTMGV
TGARDAVSNAAPELVRRVKEVSDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALTD
GIPAMRSLTEELAEGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctcgcgggcgtcttccagtcctgccatgacgagggccgttccgcgctcatt
ggctacctgcccaccggtttccctgatgtgccgcagtcgatttcggcgatgacggctttg
gtcgaggcaggctgcgacgtcatcgaggtcggcatcgcctattccgatcctggaatggac
ggccccaccatcgcagcggcgaccgaggtcgcgctgcgcgggggagtcaaggtgcgcgat
gcgttcaccgcggtcgaggccatcagcaacgccggcgggcgggcggtcgtgatgacctac
tggaatcccgtgctgagcaagggcgtcgacaccttcgctcgcgatctggcgtcggccggc
ggcctcggactgatcactccggacctgatcccggacgaggccgacgaatggctggccgcc
tccgaggcgcacgacttggacaggatcttcctcgtcgctccgtcgtcgacccccgaacga
ctggctgcgacggtgcacgcgtcgagaggattcgtgtacgcggcatcgacgatgggcgtc
accggtgcccgcgacgcggtctcgaacgcggcgccggaactggtgcgccgggtcaaagaa
gtatcggacatccccgtcggtgtcgggctcggcgtgcgctcgcgggagcaggccgcggag
atcggcgcctacgccgatggcgtcatcgtcggttctgcgctggtctctgcgctcaccgac
ggcattccggcgatgaggtcgttgaccgaggaactggcagagggcgtgcggcagaggatc
actgcgtga

DBGET integrated database retrieval system