KEGG   Mycobacterium chubuense: Mycch_2703Help
Entry
Mycch_2703        CDS       T02150                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mcb  Mycobacterium chubuense
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mcb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mcb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2793555..2794568)
Genome map
AA seq 337 aa AA seqDB search
MVSISPEQELRGVVAMGGSAGGVEALTKAAAGLPEDLPYAVLMTLHLPAHGPSVLAQIID
RAGPLPAVSAEDGAPLRAGHIYTAVPGRHLLVRDHHIALSEGPTENGHRPAINALFRSAA
VAFGPRAIGVLLSGVLDDGVLGLVAIRSRGGTTLCQEPADALFPTMPSNALRAGVVDQCA
AASDIGRLLGKLAERDQAVRSSAPDPYMELENRIAMSERFAVDMDTEKLGPPSGFTCPDC
SGSLQALGDDNYRCHIGHAWTAEALLSARDHEVQNALWIAVRSLDEKSRLAHRLRGQATS
AAMRERFSTMASETEHALAVLRERLDLIENGSGPRDG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtggtgagcatctcaccggagcaggagctgcgcggggtcgtggcgatgggtggctcggca
ggaggcgtcgaggcgctgaccaaggctgccgcgggcctgccggaggacctcccgtacgcg
gtcttgatgacgctgcacctgcccgcccatggtcccagcgtcctggcgcagatcatcgat
cgcgccggtcccctgccggccgtgtccgccgaggacggggcgccgctgcgcgcaggccac
atctacaccgctgtgccgggccgccatctgctggtccgtgaccaccacatcgcgttgtcg
gaggggcccacggagaacggccaccgccccgcgatcaacgcgctgttccgctcggcagcc
gtcgcgttcggaccgcgcgcgatcggggtgttgctgtccggggtgctcgacgacggcgtg
ctgggtctggtggccatccggtcgcgcggcgggacgacgctgtgccaggaaccggccgac
gcgctcttcccgacgatgccgagcaacgccctacgggcgggtgtggtcgaccagtgtgcc
gccgcatccgacatcggccggctactcggcaagctcgccgagcgcgaccaggcggtccgg
tcgtcggcacccgatccgtacatggagctggagaaccgcatcgcgatgtcggagcggttc
gccgtcgacatggacaccgaaaagctcggtccgccttcgggattcacgtgcccggactgc
agcggctcgctgcaggccctcggcgacgacaactaccggtgtcacatcgggcacgcgtgg
accgccgaggcgctgttgtcggcgcgtgatcacgaggtgcagaacgcgctgtggatcgcg
gtgcgcagcctggacgagaagtcacggctggcgcaccggctccgcgggcaggcgacgtcg
gcggccatgcgcgaacgcttctcgacgatggcgtccgagaccgagcacgcgctggccgtt
ctccgtgagcgtctcgacctcatcgagaatggctcggggccccgcgatggttag

DBGET integrated database retrieval system