KEGG   Mycobacterium chubuense: Mycch_2708Help
Entry
Mycch_2708        CDS       T02150                                 

Definition
(GenBank) PAS domain S-box
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb02020  Two-component system
mcb02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mycch_2708
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mycch_2708
Enzymes [BR:mcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mycch_2708
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mycch_2708
Two-component system [BR:mcb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mycch_2708
Bacterial motility proteins [BR:mcb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mycch_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheR_N PAS_4 PAS PAS_9 PAS_8 PAS_10 Methyltransf_12 Spc7 DUF1664 HOOK Syntaxin-6_N IncA PAS_7 HIP1_clath_bdg OmpH APG17 KxDL Mnd1 DUF3450 HMMR_N TPR_MLP1_2 DUF4795 DUF4618 Tropomyosin ZapB Fez1 DUF724 Atg14 ADIP Rootletin HemX Exonuc_VII_L UPF0449 Mod_r WEMBL Jnk-SapK_ap_N KASH_CCD IFT57 DUF2203 APG6 TMF_TATA_bd CALCOCO1 Bap31 DUF812 Laminin_II AAA_23 ATG16 Cluap1 DUF3584 DUF4446 GAS MCPsignal Seryl_tRNA_N RPW8 DASH_Duo1 LMBR1 DivIC TMPIT AAA_13 Ax_dynein_light FapA CENP-F_leu_zip Tweety bZIP_1 DUF3153 WXG100 NPV_P10 Golgin_A5 DUF745 DUF3552 DUF16 HAUS-augmin3 Snapin_Pallidin Phage_GP20 zf-C4H2 Fmp27_WPPW Uso1_p115_C Wtap STAT_alpha MCC-bdg_PDZ TBPIP Reo_sigmaC Prefoldin_3 V_ATPase_I DUF5089 HALZ
Motif
Other DBs
NCBI-ProteinID: AFM17471
UniProt: I4BJL4
Position
2798597..2800462
Genome map
AA seq 621 aa AA seqDB search
MNGSHLNVQSDGEATEAFEALLRYIRDARGFDFTGYKRTSLMRRARHRMDQSGHATFEEY
LDTLQASADEFAALFNTILINVTSFFRDPSAWEYVRDEVVPTLLAERNTGDPIRVWSAGC
ASGQEAYTLAMILAEAMGADEFRRRVKIYATDVDEEALAEARMASYDAKAVTAVPADLLD
RYFEPVNGRYVFRKDLRRAVIFGRNDLVKDAPISRVDLLVCRNTLMYLNADTQRNVLSRL
HFALAPRGVLLLGHAEMLLSHADRFTPLNLKYRFFRKAPTPGENIERHAAAALLERHDDA
TGLASIRDLAFRASPVAQIVVTGDDTVAMINQQAETTFGLSARDIGRLLRDLDVSFRPVE
LRAHLEKAKVERRSARIQDVQWQRAGMEPVWFEIHVNPLVDAENGLLGISIVFFDVTATR
ALVDKVVHTNRQLETAYEELQSTNEELETTNAELQSTVEELETTNEELQSTNEELETMNE
ELQSTNDELHTINDTLRERSIELDESTAFLESLESSIRLGLAVVDRRMQVAVWNRGCEEL
WGLRSDEAVGKLLPALDIGLPVDAVQPLIDRVFVDSDATGEATVDAVNRRGRATKVRVLC
SAFRGRDEAGDGALLLMEVTG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggatcgcatttgaacgtacagtccgacggagaggcgaccgaggcattcgaggct
ctgttgcgctacatccgagatgcgcgagggttcgacttcaccggctacaagcgcacctcg
ctgatgcggcgggcgcggcaccggatggaccagtccggccacgcgaccttcgaggagtac
ctcgacacgctgcaggccagcgccgacgagttcgccgcactgttcaacacgatcctcatc
aacgtcacgagcttcttccgtgatccctccgcatgggagtacgtgcgcgacgaggtcgta
cccaccctgctggccgagcgcaacacgggcgacccgatccgggtgtggagcgcaggttgc
gcctccggacaggaggcctacacgctggcgatgatcctcgccgaggcgatgggcgccgac
gagttccggcgccgggtgaagatctacgcgaccgacgtcgacgaggaggcgctcgccgag
gcgcgcatggcgtcctacgacgccaaggccgtaacggcggtgcccgccgacctgctcgac
cgctacttcgagccggtcaacggcaggtacgtcttccgcaaggatctccggcgggcggtg
atcttcggccgcaacgacctggtcaaggacgccccgatctcccgcgtcgacctgctggtg
tgccgcaacacgctgatgtatctcaacgccgacacgcagcgcaacgtgctgagccgtctg
cacttcgcgctggctccgcgaggcgtgctgttgctcgggcacgccgagatgctgctcagc
cacgccgaccgtttcaccccgctgaacctgaagtaccgcttcttccggaaggcgccgacg
cccggggagaacatcgaacgccacgccgcggcagccctgttggaacggcacgacgacgcc
accgggctcgcctcgatccgcgatctggccttccgcgccagcccggtcgcccagatcgtc
gtcaccggggacgacaccgtcgcgatgatcaaccagcaggcggagacgaccttcggcctg
tcggcgcgcgacatcggccggttgctgcgcgacctggacgtgtccttcaggccggtcgag
ctgcgggcccacctcgagaaggcgaaggtggagcgacgctcggcgcggatccaggacgtg
cagtggcagcgggccggaatggagcccgtgtggttcgagatccacgtcaacccgctcgtg
gacgccgagaacggtctgctcggcatctcgatcgtcttcttcgacgtcacggcgacacgc
gcgctggtcgacaaggtggtgcacaccaaccggcaactcgaaaccgcctacgaggagctg
cagtccaccaacgaagagctcgagaccaccaacgcggaactgcagtccaccgtcgaagag
ctcgagaccaccaacgaggaactgcagtcgaccaacgaagaactcgagacgatgaacgag
gagttgcagtcgaccaacgacgagctgcacacgatcaacgacacgctgcgtgagcgcagc
atcgagctggacgagtcgacggcattcctggaatcgctggagtcctcgatccgtttgggg
ctcgcggtggtcgaccgccggatgcaggtagcggtgtggaaccgcggctgcgaagagctg
tggggcctacgctccgacgaggcggtcggaaaactgctgcccgccctggacatcggcttg
cccgtcgacgccgtccagccgctgatcgaccgcgtgttcgtcgattcggacgccaccggc
gaggcgacggtcgacgcggtcaaccggcggggccgcgcaacgaaggtgcgggtgctgtgc
tcggcgttccgcggccgggacgaagcgggcgacggtgcactgctgctgatggaagtgacg
ggttga

DBGET integrated database retrieval system