KEGG   Mycobacterium chubuense: Mycch_2708Help
Entry
Mycch_2708        CDS       T02150                                 

Definition
PAS domain S-box
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mcb  Mycobacterium chubuense
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mcb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mcb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2798597..2800462
Genome map
AA seq 621 aa AA seqDB search
MNGSHLNVQSDGEATEAFEALLRYIRDARGFDFTGYKRTSLMRRARHRMDQSGHATFEEY
LDTLQASADEFAALFNTILINVTSFFRDPSAWEYVRDEVVPTLLAERNTGDPIRVWSAGC
ASGQEAYTLAMILAEAMGADEFRRRVKIYATDVDEEALAEARMASYDAKAVTAVPADLLD
RYFEPVNGRYVFRKDLRRAVIFGRNDLVKDAPISRVDLLVCRNTLMYLNADTQRNVLSRL
HFALAPRGVLLLGHAEMLLSHADRFTPLNLKYRFFRKAPTPGENIERHAAAALLERHDDA
TGLASIRDLAFRASPVAQIVVTGDDTVAMINQQAETTFGLSARDIGRLLRDLDVSFRPVE
LRAHLEKAKVERRSARIQDVQWQRAGMEPVWFEIHVNPLVDAENGLLGISIVFFDVTATR
ALVDKVVHTNRQLETAYEELQSTNEELETTNAELQSTVEELETTNEELQSTNEELETMNE
ELQSTNDELHTINDTLRERSIELDESTAFLESLESSIRLGLAVVDRRMQVAVWNRGCEEL
WGLRSDEAVGKLLPALDIGLPVDAVQPLIDRVFVDSDATGEATVDAVNRRGRATKVRVLC
SAFRGRDEAGDGALLLMEVTG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggatcgcatttgaacgtacagtccgacggagaggcgaccgaggcattcgaggct
ctgttgcgctacatccgagatgcgcgagggttcgacttcaccggctacaagcgcacctcg
ctgatgcggcgggcgcggcaccggatggaccagtccggccacgcgaccttcgaggagtac
ctcgacacgctgcaggccagcgccgacgagttcgccgcactgttcaacacgatcctcatc
aacgtcacgagcttcttccgtgatccctccgcatgggagtacgtgcgcgacgaggtcgta
cccaccctgctggccgagcgcaacacgggcgacccgatccgggtgtggagcgcaggttgc
gcctccggacaggaggcctacacgctggcgatgatcctcgccgaggcgatgggcgccgac
gagttccggcgccgggtgaagatctacgcgaccgacgtcgacgaggaggcgctcgccgag
gcgcgcatggcgtcctacgacgccaaggccgtaacggcggtgcccgccgacctgctcgac
cgctacttcgagccggtcaacggcaggtacgtcttccgcaaggatctccggcgggcggtg
atcttcggccgcaacgacctggtcaaggacgccccgatctcccgcgtcgacctgctggtg
tgccgcaacacgctgatgtatctcaacgccgacacgcagcgcaacgtgctgagccgtctg
cacttcgcgctggctccgcgaggcgtgctgttgctcgggcacgccgagatgctgctcagc
cacgccgaccgtttcaccccgctgaacctgaagtaccgcttcttccggaaggcgccgacg
cccggggagaacatcgaacgccacgccgcggcagccctgttggaacggcacgacgacgcc
accgggctcgcctcgatccgcgatctggccttccgcgccagcccggtcgcccagatcgtc
gtcaccggggacgacaccgtcgcgatgatcaaccagcaggcggagacgaccttcggcctg
tcggcgcgcgacatcggccggttgctgcgcgacctggacgtgtccttcaggccggtcgag
ctgcgggcccacctcgagaaggcgaaggtggagcgacgctcggcgcggatccaggacgtg
cagtggcagcgggccggaatggagcccgtgtggttcgagatccacgtcaacccgctcgtg
gacgccgagaacggtctgctcggcatctcgatcgtcttcttcgacgtcacggcgacacgc
gcgctggtcgacaaggtggtgcacaccaaccggcaactcgaaaccgcctacgaggagctg
cagtccaccaacgaagagctcgagaccaccaacgcggaactgcagtccaccgtcgaagag
ctcgagaccaccaacgaggaactgcagtcgaccaacgaagaactcgagacgatgaacgag
gagttgcagtcgaccaacgacgagctgcacacgatcaacgacacgctgcgtgagcgcagc
atcgagctggacgagtcgacggcattcctggaatcgctggagtcctcgatccgtttgggg
ctcgcggtggtcgaccgccggatgcaggtagcggtgtggaaccgcggctgcgaagagctg
tggggcctacgctccgacgaggcggtcggaaaactgctgcccgccctggacatcggcttg
cccgtcgacgccgtccagccgctgatcgaccgcgtgttcgtcgattcggacgccaccggc
gaggcgacggtcgacgcggtcaaccggcggggccgcgcaacgaaggtgcgggtgctgtgc
tcggcgttccgcggccgggacgaagcgggcgacggtgcactgctgctgatggaagtgacg
ggttga

DBGET integrated database retrieval system