KEGG   Mycobacterium chubuense: Mycch_2708Help
Entry
Mycch_2708        CDS       T02150                                 

Definition
PAS domain S-box
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mcb  Mycobacterium chubuense
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mycch_2708
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mycch_2708
Enzymes [BR:mcb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mycch_2708
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mycch_2708
Two-component system [BR:mcb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mycch_2708
Bacterial motility proteins [BR:mcb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mycch_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2798597..2800462
Genome map
AA seq 621 aa AA seqDB search
MNGSHLNVQSDGEATEAFEALLRYIRDARGFDFTGYKRTSLMRRARHRMDQSGHATFEEY
LDTLQASADEFAALFNTILINVTSFFRDPSAWEYVRDEVVPTLLAERNTGDPIRVWSAGC
ASGQEAYTLAMILAEAMGADEFRRRVKIYATDVDEEALAEARMASYDAKAVTAVPADLLD
RYFEPVNGRYVFRKDLRRAVIFGRNDLVKDAPISRVDLLVCRNTLMYLNADTQRNVLSRL
HFALAPRGVLLLGHAEMLLSHADRFTPLNLKYRFFRKAPTPGENIERHAAAALLERHDDA
TGLASIRDLAFRASPVAQIVVTGDDTVAMINQQAETTFGLSARDIGRLLRDLDVSFRPVE
LRAHLEKAKVERRSARIQDVQWQRAGMEPVWFEIHVNPLVDAENGLLGISIVFFDVTATR
ALVDKVVHTNRQLETAYEELQSTNEELETTNAELQSTVEELETTNEELQSTNEELETMNE
ELQSTNDELHTINDTLRERSIELDESTAFLESLESSIRLGLAVVDRRMQVAVWNRGCEEL
WGLRSDEAVGKLLPALDIGLPVDAVQPLIDRVFVDSDATGEATVDAVNRRGRATKVRVLC
SAFRGRDEAGDGALLLMEVTG
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggatcgcatttgaacgtacagtccgacggagaggcgaccgaggcattcgaggct
ctgttgcgctacatccgagatgcgcgagggttcgacttcaccggctacaagcgcacctcg
ctgatgcggcgggcgcggcaccggatggaccagtccggccacgcgaccttcgaggagtac
ctcgacacgctgcaggccagcgccgacgagttcgccgcactgttcaacacgatcctcatc
aacgtcacgagcttcttccgtgatccctccgcatgggagtacgtgcgcgacgaggtcgta
cccaccctgctggccgagcgcaacacgggcgacccgatccgggtgtggagcgcaggttgc
gcctccggacaggaggcctacacgctggcgatgatcctcgccgaggcgatgggcgccgac
gagttccggcgccgggtgaagatctacgcgaccgacgtcgacgaggaggcgctcgccgag
gcgcgcatggcgtcctacgacgccaaggccgtaacggcggtgcccgccgacctgctcgac
cgctacttcgagccggtcaacggcaggtacgtcttccgcaaggatctccggcgggcggtg
atcttcggccgcaacgacctggtcaaggacgccccgatctcccgcgtcgacctgctggtg
tgccgcaacacgctgatgtatctcaacgccgacacgcagcgcaacgtgctgagccgtctg
cacttcgcgctggctccgcgaggcgtgctgttgctcgggcacgccgagatgctgctcagc
cacgccgaccgtttcaccccgctgaacctgaagtaccgcttcttccggaaggcgccgacg
cccggggagaacatcgaacgccacgccgcggcagccctgttggaacggcacgacgacgcc
accgggctcgcctcgatccgcgatctggccttccgcgccagcccggtcgcccagatcgtc
gtcaccggggacgacaccgtcgcgatgatcaaccagcaggcggagacgaccttcggcctg
tcggcgcgcgacatcggccggttgctgcgcgacctggacgtgtccttcaggccggtcgag
ctgcgggcccacctcgagaaggcgaaggtggagcgacgctcggcgcggatccaggacgtg
cagtggcagcgggccggaatggagcccgtgtggttcgagatccacgtcaacccgctcgtg
gacgccgagaacggtctgctcggcatctcgatcgtcttcttcgacgtcacggcgacacgc
gcgctggtcgacaaggtggtgcacaccaaccggcaactcgaaaccgcctacgaggagctg
cagtccaccaacgaagagctcgagaccaccaacgcggaactgcagtccaccgtcgaagag
ctcgagaccaccaacgaggaactgcagtcgaccaacgaagaactcgagacgatgaacgag
gagttgcagtcgaccaacgacgagctgcacacgatcaacgacacgctgcgtgagcgcagc
atcgagctggacgagtcgacggcattcctggaatcgctggagtcctcgatccgtttgggg
ctcgcggtggtcgaccgccggatgcaggtagcggtgtggaaccgcggctgcgaagagctg
tggggcctacgctccgacgaggcggtcggaaaactgctgcccgccctggacatcggcttg
cccgtcgacgccgtccagccgctgatcgaccgcgtgttcgtcgattcggacgccaccggc
gaggcgacggtcgacgcggtcaaccggcggggccgcgcaacgaaggtgcgggtgctgtgc
tcggcgttccgcggccgggacgaagcgggcgacggtgcactgctgctgatggaagtgacg
ggttga

DBGET integrated database retrieval system