KEGG   Mycobacterium chubuense: Mycch_2807Help
Entry
Mycch_2807        CDS       T02150                                 

Definition
(GenBank) zinc-binding alcohol dehydrogenase family protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00010  Glycolysis / Gluconeogenesis
mcb00071  Fatty acid degradation
mcb00350  Tyrosine metabolism
mcb00625  Chloroalkane and chloroalkene degradation
mcb00626  Naphthalene degradation
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mycch_2807
  Lipid metabolism
   00071 Fatty acid degradation
    Mycch_2807
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mycch_2807
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mycch_2807
   00626 Naphthalene degradation
    Mycch_2807
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mycch_2807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AFM17568
UniProt: I4BJW1
Position
2931287..2932288
Genome map
AA seq 333 aa AA seqDB search
MRAWQVRRPGPMTSRPLTAAEVPVPRPADDELLVAVRACGVCRTDLHVTEGDLPVHRPGV
IPGHEVVGEVVGVGSAAVSRFAVGDRVGIAWLRHTCGTCRYCRRGQENLCPNSRYTGWDA
DGGYAEFATVPADFALPLPAGYRDAELAPLLCAGIIGYRALLRADLPPGGRLGLYGFGGS
AHLTAQVALAQGAEIHVMTRGTQARELALTLGAASAQGPADPPPVALDAAILFAPAGELV
LPALEALDRGGTLAIAGIHLSDIPSLNYQRHLFQERQVRSVTSNTRADAHAFLDFAAKHR
LEVTCPRYPLDRADEALGDLSAGRIAGAAVLVV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgtggcaggtgcgccggccgggtccgatgacctcccggccgctgaccgccgcc
gaggttcccgtcccccgacccgctgacgacgaactcctggtcgcggtgcgcgcctgcggg
gtctgccgcaccgacctgcacgtcaccgagggcgacctgcccgtccaccggcccggagtc
atcccgggccacgaggtggtcggggaggtcgtcggggtcggctctgcggccgtctcacga
ttcgcggtcggggaccgggtcgggatcgcatggcttcgtcacacctgcggcacgtgtcgg
tactgccggcgcggccaggagaacctgtgtccgaactcccgctacaccggctgggacgcc
gacgggggttacgccgagttcgccacggtccctgccgatttcgcacttccgctgcctgcg
ggctaccgcgatgccgaactcgcgccgctgctctgcgcgggcatcatcggttaccgggcg
ctgctgcgcgccgacctgccgcccggcggccgcctgggcctctacggcttcggcggcagt
gcccatctgaccgcgcaggtcgcgctcgcgcagggcgccgagatccacgtcatgacccgg
gggacccaggctcgcgaactggcactgacgctcggcgcggcctcggcgcagggcccggcc
gatccgccgcccgtcgcgctggacgccgcgatcctgttcgcccccgccggcgagctggtg
ctcccggccctcgaagcgctcgaccggggcggcacgctggccatcgcagggatccacctc
agcgacatcccgtcgctgaactatcagcgtcacctgttccaggagcggcaggtccgctcg
gtaacgtcgaacacccgcgccgacgcccatgcgttcctcgacttcgcggcgaagcatcgg
ctcgaggtcacctgcccccgctatccgctggacagggccgacgaagcactcggcgacctc
agcgccggacgcatcgccggggctgcggtcctggtcgtgtag

DBGET integrated database retrieval system