KEGG   Mycobacterium chubuense: Mycch_3168Help
Entry
Mycch_3168        CDS       T02150                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mcb  Mycobacterium chubuense
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mycch_3168
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mycch_3168
Enzymes [BR:mcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mycch_3168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3308559..3310037)
Genome map
AA seq 492 aa AA seqDB search
MSALTADGGGIPAVRLSGVTLRGQSAQPGDLFAALPGSRAHGARYAADAVARGAVAVLTD
RDGAAEIAQGAALDVPVLVHPEPRTVLGEVASAVYGHPSQHLRVIGVTGTSGKTTTTYLV
DAGLRAADRVGGLIGTVGVRIDGRDQQGGLTTPEAPDLQALLAVMVEQGVDTVVMEVSSH
ALMLGRVDGVRFAVGGFTNLSRDHLDFHPTMDDYFDAKARLFDPASPTRAAQSVICVDDD
WGRAMARRAGHAVTVSTTRAADWRVEDVRSGDGGVQEFLAVDPAGVHHGLQIRLPGRYNV
ANCLLAVALLDAVGVSPEQAAPGLRDAAVPGRLETVDRGQPFLALVDYAHKPGALEAVLQ
TLKEQCSGRLVVVFGAGGNRDPGKREPMGRVAAELADLVVVTDDNPRDEDPAAIRAAIVA
GAQGAGADVVEIGDRRAAIGHAVASARAGDVVLIAGKGHESGQTRGGRTLPFDDREELAA
ALQASGARGSRR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgcgctgaccgcggacggcggcggaatccccgcggtccggctcagcggggtgacg
ctgcgcggccagagcgcgcagcccggcgacctgttcgcggcacttcccggttcgcgcgcc
cacggtgcccgctacgccgccgacgccgtggcccggggcgcggtggccgtgctgaccgac
cgcgacggggccgccgagatcgcgcagggggccgccctcgacgtgccggtcctcgtccac
cccgagcccaggaccgtgctgggcgaggtggcgtccgccgtctacggccacccgtcacag
cacctgcgcgtcatcggtgtcacggggacatcgggcaagaccacgaccacctacctcgtc
gacgccgggctgcgggccgccgaccgggtgggcgggctgatcggtaccgtcggtgtccgc
atcgacggccgcgaccagcaggggggcctcaccacaccggaagcgcccgacctgcaggcg
ctgctggcggtgatggtcgagcagggcgtggacaccgtcgtgatggaagtctccagccat
gcgctgatgctcggccgcgtcgacggagtgcggttcgcggtcggcggtttcacgaacctg
tcgcgggaccatctggacttccacccgacgatggacgactacttcgacgccaaggcgcgt
ctgttcgatcccgcgtcgccgacccgcgcggcacagtcggtgatctgcgtcgacgacgac
tggggccgcgcgatggcgcgccgcgccgggcatgccgtcacggtcagcacgacccgggcc
gcggactggcgggtcgaggacgtccgctccggcgacggcggcgtccaggagtttctggcc
gtggatcccgccggggtccatcacggcctgcagatccggctgcccggccgctacaacgtg
gcgaactgcctgttggccgtggcgttgctcgacgcggtcggggtgtcgccggaacaggcc
gcgcccgggttgcgggacgccgcggtgcccggccggctggagaccgtcgaccgcgggcag
ccgtttttggccctcgtcgattacgcccacaagccaggagcgctggaggccgtgttgcag
accctcaaggagcagtgttccgggcggttggtcgtggtgttcggggccggcggcaaccgg
gacccgggcaagcgggagccgatgggccgggtggccgccgaactggccgacctggtcgtg
gtgaccgacgacaacccgcgcgacgaggacccggccgccatccgcgcggcgatcgtcgca
ggtgcgcagggtgccggcgccgacgtcgtggagatcggggaccgccgcgcggcgatcggg
cacgccgtggcctccgcacgcgccggcgacgtcgtattgatcgccggcaagggacacgag
tcgggccagacccggggcggacggacgttgccgttcgacgaccgcgaggaactcgctgcg
gcgttgcaggcctcgggcgcgcgggggtcgcgccgttga

DBGET integrated database retrieval system