KEGG   Mycobacterium chubuense: Mycch_3204Help
Entry
Mycch_3204        CDS       T02150                                 

Definition
asparagine synthase, glutamine-hydrolyzing
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mcb  Mycobacterium chubuense
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mycch_3204
Enzymes [BR:mcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Mycch_3204
Peptidases [BR:mcb01002]
 Cysteine Peptidases
  Family C44
   Mycch_3204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3345365..3347296
Genome map
AA seq 643 aa AA seqDB search
MCGLLALVTDPASEVSSTVVDAVSGATAQMRHRGPDEPGTWNDGRVVLGFNRLSIIDIAH
SHQPLRWGPRDAPDRYTLVFNGEIYNYLELREELRTEFGAVFHTDGDGEAILAAFHHWGP
EALTRLRGMFAFALWDSVEQELFCARDPFGIKPLFMATGPGGTAVGSEKKCLLDLAGQLG
IDLGIDDRAVQHYTVLQYVPEPETLHRGIRRLESGSYARVRPGQQPRVTRYFTPQFTAVP
FGAGGEQRRYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAMRHNPRLITFTT
GFEREGFSEVDVAVASAEAIGARHVTKVVSQEEFVAALPEIVWYLDEPVADPALVPLFFI
AREARKHVKVVLSGEGADELFGGYTIYREPLSLKPFEYLPRGLRKSVGKMAGPLPEGMRG
KSLLHRGSLTLEERYYGNARSFSDAQLQAVLPRFRQEWTHTDVTAPVYAQSQGWDPVARM
QHIDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFAVAARLPYDQKITRATTKYALR
RALEPIVPAHVLNRPKLGFPVPIRHWLRAGELLDWAYGMVGASTAGDLVDLAAVRSMLDE
HRSGTADHSRRLWTVLIFMLWYAIFVDKSVTPQIAEPTYPVQL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggactgctggcgctggtgaccgacccggcctctgaggtttcctccaccgtggtc
gacgccgtgtcgggggccacggcgcagatgcgccaccgcggcccggacgaacccgggacc
tggaacgacggccgggtggtgctcggcttcaaccggctgtcgatcatcgacatcgcgcac
agtcaccaaccgctgcggtggggaccccgcgacgcgcccgaccggtacacgctcgtgttc
aacggcgagatctacaactatctggaactgcgtgaggagctgcgcaccgagttcggcgcg
gtgttccacaccgacggcgacggcgaggcgatcctcgcggcgttccatcactgggggccc
gaagcgttgacacggctgcgcggcatgttcgccttcgcactgtgggacagcgtcgaacag
gaactgttctgcgcccgtgaccccttcggcatcaagccgctgttcatggcgacgggcccg
ggcggaaccgcggtcggcagcgagaagaagtgcctgctcgacctggccgggcagctgggg
atcgacctcggcatcgacgaccgcgccgtccagcactacacggtgctgcaatacgtgccg
gagcccgagaccctgcaccggggcatccggaggctggagtcgggcagttacgcccgggtg
cgccccggacagcagccccgcgtcacccggtacttcacgccgcagttcaccgcggtgccg
ttcggcgccggcggtgagcagcgccgctacgacgagatcaccgcggtcctcgaggactcg
gtcgccaagcacatgcgcgccgacgtcaccgtgggcgccttcctgtccggcggcatcgac
tcgacggcgatcgcggcgctggccatgcgccacaacccgcggctgatcaccttcaccacc
ggtttcgaacgcgagggcttctccgaggtggatgtggcggtcgcctcggccgaggccatc
ggcgcccggcacgtgaccaaggtggtcagccaggaggagttcgtcgccgcgctgcccgag
atcgtctggtacctcgacgaacccgtcgccgaccccgcgctggtgccgttgttcttcatc
gccagggaggcgcgcaagcacgtcaaggtcgtgctgtccggcgaaggggccgacgagctg
ttcggcggctacacgatttatcgggagcccttgtcgctcaagcctttcgagtatctgccg
cgcggccttcgcaagtcggtgggcaagatggccggaccgctgcccgagggcatgcgcggc
aagagcctgctgcaccgcgggtcactcaccctggaggagcgctactacggcaacgcgcgc
agcttctccgatgcccagctgcaggccgtgttgccgcggttccgtcaggagtggacgcac
accgacgtcaccgcaccggtgtacgcgcagtcgcagggctgggatccggtggcgcggatg
cagcacatcgacctgttcacctggctgcgcggcgacatcctggtcaaggcggacaagatg
acgatggccaactcgctggagttgcgcgtgccgttcctcgatcccgaggtcttcgccgtg
gccgcccggctgccctacgaccagaagatcacccgggcgacgacgaagtatgcgctgcgg
cgcgcgctggaaccgatcgtgcccgcgcatgtgctgaatcggccgaagctggggttcccg
gtgccgatccggcactggctacgcgccggcgagctgctggactgggcctacggcatggtc
ggcgcgtcgactgcaggcgatctcgtcgacctggccgcggtgcgctcgatgctcgacgaa
caccgtagcggcaccgccgatcacagccgccgtttgtggacggtgctgatcttcatgctc
tggtacgcgatcttcgtcgacaagagcgtcacgcctcagatcgccgagccgacctatccg
gtgcagctgtag

DBGET integrated database retrieval system