KEGG   Mycobacterium chubuense: Mycch_3219Help
Entry
Mycch_3219        CDS       T02150                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcb  Mycobacterium chubuense
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_3219
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycch_3219
  Amino acid metabolism
   00310 Lysine degradation
    Mycch_3219
Enzymes [BR:mcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mycch_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3360373..3362235
Genome map
AA seq 620 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPAAGVLKKIV
AQEDDTVEVGGELAVIGDADKDGGEEAEEPSGDSEAEAESEPEPESEPEPEPEPEQEPEP
EQESKPKSSGSAGSSKSSGSSTPVVMPELGESVTEGTVTRWLKKVGDSVEVDEPLVEVST
DKVDTEIPSPVAGTLLSITAEEDDTVEVGGELAKIGDEGAEGAAEPEPEPEPEPEQEPEE
AEETEPEAKPAEEAEPEPESKPEPKSEPEPKPKAEPKPKSEPKPKPEPEPKPAAAEAPSG
ESGPYVTPLVRKLAGEHGVDLAAVKGTGVGGRIRKQDVLAAAEAKKAPSGTEKSAEAPSK
APAAAMAPADANAADAPLAHLRGTTQKANRIRQLTAKKTRESLQATAQLTQTHEVDMTKI
VALRAKAKAAFAEREGVNLTYLPFIARAVIDALKMHPNVNASYNEDSKEITYYDAEHLGF
AVDTEQGLLSPVIKNAGDLSLGGLARAIADIAARARSGDLKPDELSGGTFTITNIGSQGA
LFDTPILVPPQAAMLGTGAIVKRPRVIVDEFGNESIGVRSVCYLPLTYDHRLIDGADAGR
FVTTIKRRLEEGSFEADLGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgttcagatgcccgcactcggcgagagcgttaccgaggggacagtcacc
cgctggctcaagcaagagggtgacacggtcgaggaggatgagccgctgctggaggtgtcg
accgacaaggtcgacaccgagatcccgtcgccggccgcgggtgtgctgaagaagatcgtc
gcccaggaggacgacaccgtcgaggtgggcggcgagctcgcggtgatcggcgacgcggac
aaggacggcggcgaggaagccgaggagccctccggcgactccgaagcggaagccgagtcc
gagcccgaaccggagtccgagcctgaaccggagcccgagccggagcaggagccggagccg
gagcaggaatcgaagcccaagtcgtcggggtcggccggatcgtcgaagtcgtcgggatcc
tcgaccccggtggtgatgcccgagctcggtgagtccgtcaccgagggcacggtcacccgc
tggctgaagaaggtcggcgacagcgtggaggtcgacgagccgctggtcgaggtctccacc
gacaaggtcgacaccgagatcccgtcaccggtcgcgggcaccttgctgtccatcaccgcc
gaagaggacgacacggtcgaggtgggcggcgagttggccaagatcggcgacgagggcgcg
gagggcgccgccgagcccgaacccgaacccgaaccggagccggaacaggagcccgaagag
gccgaggagaccgagcccgaggcgaagcccgccgaagaagccgagcccgagccggagagc
aagcccgaacccaagtcggagccagaacccaagcccaaggcggagcccaagcccaagtcg
gagcccaagcccaagcccgagccggaacccaagccggctgcggccgaagccccctcaggc
gagtcgggaccgtacgtcacgccgctggtgcgcaagctcgccggtgagcacggcgtcgac
ctggccgccgtcaagggcaccggcgtcggcgggcgcatccgcaagcaggacgtgctcgca
gcagcggaagccaagaaggcgccgtcggggaccgagaagtccgccgaggcgccgtcgaag
gcgcctgccgcggcgatggcaccggctgatgcgaacgccgccgacgcaccgctggcgcac
ctgcgcggcacgacgcagaaggcgaaccgcatccgccagctgaccgcgaagaagacccgc
gaatccctgcaggcgacagcgcaattgacgcagacccacgaggtcgacatgaccaagatc
gtggccctccgcgccaaggccaaggccgcgttcgccgagcgcgagggcgtcaacctcacc
tatctgccgttcatcgcgcgcgccgtgatcgacgcgctgaagatgcacccgaacgtcaac
gccagctacaacgaggactccaaggagatcacctactacgacgccgaacacctcggcttc
gccgtggacaccgagcagggcctgctctccccggtgatcaagaacgccggcgacctgtcg
ctgggcgggctcgcccgggcgatcgccgacatcgcggcgcgggcgcgctcgggtgacctg
aagcccgacgaattgtccggtggcacgttcacgatcacgaacatcggcagccagggcgcc
ctcttcgacaccccgatcctcgtcccgccgcaggcggcgatgctgggcaccggtgcgatc
gtcaagcggccgcgggtgatcgtcgacgaattcggcaacgagtcgatcggtgtgcggtcg
gtgtgctacctgccgctgacctacgaccaccgcctgatcgacggcgccgacgccggccga
ttcgtcaccacgatcaagcgccgcctcgaagagggttcgttcgaggcagacttgggtctg
tag

DBGET integrated database retrieval system