KEGG   Mycobacterium chubuense: Mycch_3219Help
Entry
Mycch_3219        CDS       T02150                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcb  Mycobacterium chubuense
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_3219
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycch_3219
  Amino acid metabolism
   00310 Lysine degradation
    Mycch_3219
Enzymes [BR:mcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mycch_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3360373..3362235
Genome map
AA seq 620 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPAAGVLKKIV
AQEDDTVEVGGELAVIGDADKDGGEEAEEPSGDSEAEAESEPEPESEPEPEPEPEQEPEP
EQESKPKSSGSAGSSKSSGSSTPVVMPELGESVTEGTVTRWLKKVGDSVEVDEPLVEVST
DKVDTEIPSPVAGTLLSITAEEDDTVEVGGELAKIGDEGAEGAAEPEPEPEPEPEQEPEE
AEETEPEAKPAEEAEPEPESKPEPKSEPEPKPKAEPKPKSEPKPKPEPEPKPAAAEAPSG
ESGPYVTPLVRKLAGEHGVDLAAVKGTGVGGRIRKQDVLAAAEAKKAPSGTEKSAEAPSK
APAAAMAPADANAADAPLAHLRGTTQKANRIRQLTAKKTRESLQATAQLTQTHEVDMTKI
VALRAKAKAAFAEREGVNLTYLPFIARAVIDALKMHPNVNASYNEDSKEITYYDAEHLGF
AVDTEQGLLSPVIKNAGDLSLGGLARAIADIAARARSGDLKPDELSGGTFTITNIGSQGA
LFDTPILVPPQAAMLGTGAIVKRPRVIVDEFGNESIGVRSVCYLPLTYDHRLIDGADAGR
FVTTIKRRLEEGSFEADLGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgttcagatgcccgcactcggcgagagcgttaccgaggggacagtcacc
cgctggctcaagcaagagggtgacacggtcgaggaggatgagccgctgctggaggtgtcg
accgacaaggtcgacaccgagatcccgtcgccggccgcgggtgtgctgaagaagatcgtc
gcccaggaggacgacaccgtcgaggtgggcggcgagctcgcggtgatcggcgacgcggac
aaggacggcggcgaggaagccgaggagccctccggcgactccgaagcggaagccgagtcc
gagcccgaaccggagtccgagcctgaaccggagcccgagccggagcaggagccggagccg
gagcaggaatcgaagcccaagtcgtcggggtcggccggatcgtcgaagtcgtcgggatcc
tcgaccccggtggtgatgcccgagctcggtgagtccgtcaccgagggcacggtcacccgc
tggctgaagaaggtcggcgacagcgtggaggtcgacgagccgctggtcgaggtctccacc
gacaaggtcgacaccgagatcccgtcaccggtcgcgggcaccttgctgtccatcaccgcc
gaagaggacgacacggtcgaggtgggcggcgagttggccaagatcggcgacgagggcgcg
gagggcgccgccgagcccgaacccgaacccgaaccggagccggaacaggagcccgaagag
gccgaggagaccgagcccgaggcgaagcccgccgaagaagccgagcccgagccggagagc
aagcccgaacccaagtcggagccagaacccaagcccaaggcggagcccaagcccaagtcg
gagcccaagcccaagcccgagccggaacccaagccggctgcggccgaagccccctcaggc
gagtcgggaccgtacgtcacgccgctggtgcgcaagctcgccggtgagcacggcgtcgac
ctggccgccgtcaagggcaccggcgtcggcgggcgcatccgcaagcaggacgtgctcgca
gcagcggaagccaagaaggcgccgtcggggaccgagaagtccgccgaggcgccgtcgaag
gcgcctgccgcggcgatggcaccggctgatgcgaacgccgccgacgcaccgctggcgcac
ctgcgcggcacgacgcagaaggcgaaccgcatccgccagctgaccgcgaagaagacccgc
gaatccctgcaggcgacagcgcaattgacgcagacccacgaggtcgacatgaccaagatc
gtggccctccgcgccaaggccaaggccgcgttcgccgagcgcgagggcgtcaacctcacc
tatctgccgttcatcgcgcgcgccgtgatcgacgcgctgaagatgcacccgaacgtcaac
gccagctacaacgaggactccaaggagatcacctactacgacgccgaacacctcggcttc
gccgtggacaccgagcagggcctgctctccccggtgatcaagaacgccggcgacctgtcg
ctgggcgggctcgcccgggcgatcgccgacatcgcggcgcgggcgcgctcgggtgacctg
aagcccgacgaattgtccggtggcacgttcacgatcacgaacatcggcagccagggcgcc
ctcttcgacaccccgatcctcgtcccgccgcaggcggcgatgctgggcaccggtgcgatc
gtcaagcggccgcgggtgatcgtcgacgaattcggcaacgagtcgatcggtgtgcggtcg
gtgtgctacctgccgctgacctacgaccaccgcctgatcgacggcgccgacgccggccga
ttcgtcaccacgatcaagcgccgcctcgaagagggttcgttcgaggcagacttgggtctg
tag

DBGET integrated database retrieval system