KEGG   Mycobacterium chubuense: Mycch_3219Help
Entry
Mycch_3219        CDS       T02150                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mcb  Mycobacterium chubuense
Pathway
mcb00020  Citrate cycle (TCA cycle)
mcb00310  Lysine degradation
mcb01100  Metabolic pathways
mcb01110  Biosynthesis of secondary metabolites
mcb01120  Microbial metabolism in diverse environments
mcb01130  Biosynthesis of antibiotics
mcb01200  Carbon metabolism
Module
mcb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mcb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycch_3219
  Amino acid metabolism
   00310 Lysine degradation
    Mycch_3219
Enzymes [BR:mcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mycch_3219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 Trypan_PARP GCV_H DUF2254
Motif
Other DBs
NCBI-ProteinID: AFM17967
UniProt: I4BL10
Position
3360373..3362235
Genome map
AA seq 620 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPAAGVLKKIV
AQEDDTVEVGGELAVIGDADKDGGEEAEEPSGDSEAEAESEPEPESEPEPEPEPEQEPEP
EQESKPKSSGSAGSSKSSGSSTPVVMPELGESVTEGTVTRWLKKVGDSVEVDEPLVEVST
DKVDTEIPSPVAGTLLSITAEEDDTVEVGGELAKIGDEGAEGAAEPEPEPEPEPEQEPEE
AEETEPEAKPAEEAEPEPESKPEPKSEPEPKPKAEPKPKSEPKPKPEPEPKPAAAEAPSG
ESGPYVTPLVRKLAGEHGVDLAAVKGTGVGGRIRKQDVLAAAEAKKAPSGTEKSAEAPSK
APAAAMAPADANAADAPLAHLRGTTQKANRIRQLTAKKTRESLQATAQLTQTHEVDMTKI
VALRAKAKAAFAEREGVNLTYLPFIARAVIDALKMHPNVNASYNEDSKEITYYDAEHLGF
AVDTEQGLLSPVIKNAGDLSLGGLARAIADIAARARSGDLKPDELSGGTFTITNIGSQGA
LFDTPILVPPQAAMLGTGAIVKRPRVIVDEFGNESIGVRSVCYLPLTYDHRLIDGADAGR
FVTTIKRRLEEGSFEADLGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggccatctccgttcagatgcccgcactcggcgagagcgttaccgaggggacagtcacc
cgctggctcaagcaagagggtgacacggtcgaggaggatgagccgctgctggaggtgtcg
accgacaaggtcgacaccgagatcccgtcgccggccgcgggtgtgctgaagaagatcgtc
gcccaggaggacgacaccgtcgaggtgggcggcgagctcgcggtgatcggcgacgcggac
aaggacggcggcgaggaagccgaggagccctccggcgactccgaagcggaagccgagtcc
gagcccgaaccggagtccgagcctgaaccggagcccgagccggagcaggagccggagccg
gagcaggaatcgaagcccaagtcgtcggggtcggccggatcgtcgaagtcgtcgggatcc
tcgaccccggtggtgatgcccgagctcggtgagtccgtcaccgagggcacggtcacccgc
tggctgaagaaggtcggcgacagcgtggaggtcgacgagccgctggtcgaggtctccacc
gacaaggtcgacaccgagatcccgtcaccggtcgcgggcaccttgctgtccatcaccgcc
gaagaggacgacacggtcgaggtgggcggcgagttggccaagatcggcgacgagggcgcg
gagggcgccgccgagcccgaacccgaacccgaaccggagccggaacaggagcccgaagag
gccgaggagaccgagcccgaggcgaagcccgccgaagaagccgagcccgagccggagagc
aagcccgaacccaagtcggagccagaacccaagcccaaggcggagcccaagcccaagtcg
gagcccaagcccaagcccgagccggaacccaagccggctgcggccgaagccccctcaggc
gagtcgggaccgtacgtcacgccgctggtgcgcaagctcgccggtgagcacggcgtcgac
ctggccgccgtcaagggcaccggcgtcggcgggcgcatccgcaagcaggacgtgctcgca
gcagcggaagccaagaaggcgccgtcggggaccgagaagtccgccgaggcgccgtcgaag
gcgcctgccgcggcgatggcaccggctgatgcgaacgccgccgacgcaccgctggcgcac
ctgcgcggcacgacgcagaaggcgaaccgcatccgccagctgaccgcgaagaagacccgc
gaatccctgcaggcgacagcgcaattgacgcagacccacgaggtcgacatgaccaagatc
gtggccctccgcgccaaggccaaggccgcgttcgccgagcgcgagggcgtcaacctcacc
tatctgccgttcatcgcgcgcgccgtgatcgacgcgctgaagatgcacccgaacgtcaac
gccagctacaacgaggactccaaggagatcacctactacgacgccgaacacctcggcttc
gccgtggacaccgagcagggcctgctctccccggtgatcaagaacgccggcgacctgtcg
ctgggcgggctcgcccgggcgatcgccgacatcgcggcgcgggcgcgctcgggtgacctg
aagcccgacgaattgtccggtggcacgttcacgatcacgaacatcggcagccagggcgcc
ctcttcgacaccccgatcctcgtcccgccgcaggcggcgatgctgggcaccggtgcgatc
gtcaagcggccgcgggtgatcgtcgacgaattcggcaacgagtcgatcggtgtgcggtcg
gtgtgctacctgccgctgacctacgaccaccgcctgatcgacggcgccgacgccggccga
ttcgtcaccacgatcaagcgccgcctcgaagagggttcgttcgaggcagacttgggtctg
tag

DBGET integrated database retrieval system