KEGG   Mycobacterium chubuense: Mycch_3526Help
Entry
Mycch_3526        CDS       T02150                                 

Definition
enoyl-CoA hydratase/carnithine racemase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcb  Mycobacterium chubuense
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Mycch_3526
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycch_3526
   00650 Butanoate metabolism
    Mycch_3526
  Lipid metabolism
   00071 Fatty acid degradation
    Mycch_3526
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycch_3526
   00310 Lysine degradation
    Mycch_3526
   00360 Phenylalanine metabolism
    Mycch_3526
   00380 Tryptophan metabolism
    Mycch_3526
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mycch_3526
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mycch_3526
   00281 Geraniol degradation
    Mycch_3526
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycch_3526
   00627 Aminobenzoate degradation
    Mycch_3526
   00930 Caprolactam degradation
    Mycch_3526
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mycch_3526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3721113..3721847
Genome map
AA seq 244 aa AA seqDB search
MQVEDRVALITVNDPDRRNAVTAEISAALRAAVDTAEADPNVHALIVTGAGKAFCAGADL
TALGAATESGLRVIYDGFLAVADCALPTIAAVNGPAVGAGLNLALAADVRIAGSAALFDP
RFQKLGIHPGGGATWMLQRAIGPQAARAALLFGMRFDADAAVRHGLALDVADDPVAAARE
LAAGPASAPREVVMATKASMRACANPGISDIHQHHMAVDIEIGPQARSIESPEFAARLAA
AKRK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcgaagaccgcgtcgccctcatcaccgtcaatgacccagaccgacgcaacgcg
gtgacagcggagatctccgcagccctgcgcgctgccgtcgacaccgccgaggcagatccg
aatgtccatgcgctgatcgtgaccggcgcgggcaaggccttctgcgccggcgccgacctg
accgcgctgggcgccgccaccgagagcggcctgcgcgtgatctacgacggcttcctcgcc
gtggccgactgcgcactacccaccatcgccgccgtcaacgggccggccgtcggcgcaggc
ctgaacctcgcgctggctgccgacgtccggatcgccggttccgcagcgcttttcgaccca
cgcttccagaagctgggcatccatcccggcggcggcgccacctggatgctgcagcgtgcg
atagggccgcaggcggcccgcgcggcgctgctgttcgggatgcgcttcgatgccgatgcg
gccgtccgccacgggctcgcgctcgatgtcgccgacgatcccgtcgcggcggcccgtgag
ctggcggccgggccggcgtccgcaccgcgcgaggtcgtgatggcgacgaaggcgtcgatg
cgggcctgcgccaaccccggcatctccgacatccatcagcaccacatggccgtcgacatc
gagatcgggccgcaagcgcgctcgatcgagtcccccgagttcgccgcgcggctggccgcc
gccaagcggaagtag

DBGET integrated database retrieval system