KEGG   Mycobacterium chubuense: Mycch_3527Help
Entry
Mycch_3527        CDS       T02150                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mcb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mcb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mcb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mcb00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3721850..3723001)
Genome map
AA seq 383 aa AA seqDB search
MSAVREFLVPDLGEGLEDATITSWQVAIGDEVALNQTLCTVETNKAAVEIPSPFAGRVTE
LGGAEGQTLAVGAVLVRIETEAAAVRTPVLVGYGTDDTMDGSRRRARAIPPVRKLAAELD
VDLAHLAPGSGPDGIVTRADVLAAASATGAQEAPVDTAVTGVRLEMARRMALSRSEIPDA
NASVEVAGTELLRVRDILRDAGAEAITPFVLLLRLLVVALRRHPVLNATWLDTLDGPRVH
VHPSVHLGVGVAAPRGLLVPVVRDAQMRTTRALAEEVGRLVEAARNGTLTPTELQGSTFT
VSNFGALGLDDGVPVINHPEAAILGVGALKPRAVVVDGAVVARPTMRLTCAFDHRVADGA
QVAGFLGDLRGLIEAPELALLDL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgtgcgggagttcctggttcccgacctcggcgagggcctcgaggacgccacc
atcacgagctggcaggtcgcgatcggagacgaggtcgccttgaaccagacgctgtgcacc
gtcgagaccaacaaggccgcggtagagatccccagtccgttcgccggccgggtcaccgag
ctcggcggcgccgaggggcagacgctcgcggtcggtgcggtcctggtgcggatcgagacc
gaggccgctgccgtacgcacgccggtgctggtcgggtacggcaccgacgacacgatggac
ggcagcaggcggcgggcccgggccataccgcccgtgcgcaagctggcggccgaactggac
gtggacctggcgcacctcgcacccggatcgggaccggacggaatcgtcacccgggccgac
gtactggcggccgcgtcggccaccggcgcgcaggaagctcctgtcgacacggccgtcacg
ggcgtgcggctggagatggcacgccggatggcgttgtcgcgcagcgaaattcccgacgcg
aacgcgtccgtcgaggtagccggaaccgaactgctgcgcgtgcgggacatactccgggac
gccggagccgaggcgatcaccccgttcgtgctgctgctgcggctgctcgtggtggcactc
cgccgacaccccgtgctcaacgcgacgtggctggacacgctggacggtccgcgcgtccac
gtgcacccctcggtgcacctcggtgtcggtgtcgcggcgccgcggggattgctggtgccg
gtcgtgcgcgacgcgcagatgcgcaccacgcgggcgctcgccgaggaggtcggccgtctg
gtcgaggcggcccgcaacggcacgctcacgccgacggagctgcagggctcgacgttcacg
gtgtcgaacttcggtgcgctcggcctcgatgacggtgtccccgtgatcaaccatcccgag
gcggcgatcctcggcgtgggggcgctcaagccgcgggccgtcgtggtcgacggggccgtc
gtcgcgcgccccacgatgaggctcacgtgcgcgttcgatcatcgcgtcgccgacggcgcg
caggtggcggggttcctgggcgacctgcgagggttgatcgaggcgcccgagctggcgctg
ctcgacctgtag

DBGET integrated database retrieval system