KEGG   Mycobacterium chubuense: Mycch_3788Help
Entry
Mycch_3788        CDS       T02150                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mcb01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mcb00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:mcb00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3991181..3992266)
Genome map
AA seq 361 aa AA seqDB search
MSTTAPRAVHQPWPGLIEAYRERLPVEDSWTPITLREGGTPLLPAPRLSEYTGCTVHLKV
EGLNPTGSFKDRGMTMAVTEAVARGQQAVLCASTGNTSASAAAYAARAGITCAVLVPQGK
IAMGKLAQAVMHGAKIIQIDGNFDDCLELARKLTADFPTVSLVNSVNPFRIEGQKTAAFE
IIDALGEAPDIHALPVGNAGNITAYWKGYTEYHRDGLTGRLPRMLGTQAAGAAPLVLGEP
VSDPETIATAIRIGSPASWTSAVEAQQQSGGRFLAATDEEILAAYHLVARAEGVFVEPAS
AASIAGLLKSIEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPAVIPVPVDPVAVVAKLGL
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccaccgcaccccgcgccgtgcaccagccctggccgggcctgatcgaggcctac
cgcgagcggctgcccgtcgaggacagctggacgcccatcactctgcgggaaggcggcacg
ccgctgttgcccgccccgcgcctgtccgaatacaccggctgcaccgtgcatctcaaggtc
gaagggctcaatccgaccggctccttcaaggatcgcggcatgacgatggccgtgaccgag
gcggtggcccgcggccagcaggcggtgctgtgcgcgtccaccggcaacacctcggcgtcg
gccgccgcctacgccgcacgcgccgggatcacctgtgcggtactggttccgcagggcaag
atcgcgatgggcaagctggcgcaggcggtcatgcacggcgccaagatcatccagatcgac
gggaacttcgacgactgcctcgagctggcccgcaagctcaccgcggactttcccacggtg
tcacttgtcaactccgtcaaccccttccgtatcgagggacagaagaccgcggcgttcgag
atcatcgacgcgctcggcgaggcgcccgacatccacgcgctgcccgtcggcaacgccggc
aacatcacggcgtactggaagggctacaccgagtaccaccgcgacgggctgaccggccgg
ctgccgcgcatgctcggcacgcaggccgccggggcggcgccgctggtgctcggcgagccg
gtgagtgaccccgagaccatcgccaccgcgatccgcatcgggtcgccggcctcgtggacc
tccgcggtcgaggcgcagcagcagtccggcggccgcttcctggccgccaccgacgaggag
atcctcgccgcctaccacctggtggcgcgagccgagggcgtgttcgtcgaacccgcgtcg
gcggccagcatcgccgggctgctcaagtccatcgaagacgggtgggtcgccaagggttcc
accgtggtgtgcaccgtcaccggcaacggcctgaaggacccggacaccgctctgaagggc
atgcccgcggttatcccggtgcccgtcgaccccgtcgccgtcgtcgccaagctcggcctg
gtctag

DBGET integrated database retrieval system