KEGG   Mycobacterium chubuense: Mycch_3788Help
Entry
Mycch_3788        CDS       T02150                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mycch_3788
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mycch_3788
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mycch_3788
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mycch_3788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3991181..3992266)
Genome map
AA seq 361 aa AA seqDB search
MSTTAPRAVHQPWPGLIEAYRERLPVEDSWTPITLREGGTPLLPAPRLSEYTGCTVHLKV
EGLNPTGSFKDRGMTMAVTEAVARGQQAVLCASTGNTSASAAAYAARAGITCAVLVPQGK
IAMGKLAQAVMHGAKIIQIDGNFDDCLELARKLTADFPTVSLVNSVNPFRIEGQKTAAFE
IIDALGEAPDIHALPVGNAGNITAYWKGYTEYHRDGLTGRLPRMLGTQAAGAAPLVLGEP
VSDPETIATAIRIGSPASWTSAVEAQQQSGGRFLAATDEEILAAYHLVARAEGVFVEPAS
AASIAGLLKSIEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPAVIPVPVDPVAVVAKLGL
V
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaccaccgcaccccgcgccgtgcaccagccctggccgggcctgatcgaggcctac
cgcgagcggctgcccgtcgaggacagctggacgcccatcactctgcgggaaggcggcacg
ccgctgttgcccgccccgcgcctgtccgaatacaccggctgcaccgtgcatctcaaggtc
gaagggctcaatccgaccggctccttcaaggatcgcggcatgacgatggccgtgaccgag
gcggtggcccgcggccagcaggcggtgctgtgcgcgtccaccggcaacacctcggcgtcg
gccgccgcctacgccgcacgcgccgggatcacctgtgcggtactggttccgcagggcaag
atcgcgatgggcaagctggcgcaggcggtcatgcacggcgccaagatcatccagatcgac
gggaacttcgacgactgcctcgagctggcccgcaagctcaccgcggactttcccacggtg
tcacttgtcaactccgtcaaccccttccgtatcgagggacagaagaccgcggcgttcgag
atcatcgacgcgctcggcgaggcgcccgacatccacgcgctgcccgtcggcaacgccggc
aacatcacggcgtactggaagggctacaccgagtaccaccgcgacgggctgaccggccgg
ctgccgcgcatgctcggcacgcaggccgccggggcggcgccgctggtgctcggcgagccg
gtgagtgaccccgagaccatcgccaccgcgatccgcatcgggtcgccggcctcgtggacc
tccgcggtcgaggcgcagcagcagtccggcggccgcttcctggccgccaccgacgaggag
atcctcgccgcctaccacctggtggcgcgagccgagggcgtgttcgtcgaacccgcgtcg
gcggccagcatcgccgggctgctcaagtccatcgaagacgggtgggtcgccaagggttcc
accgtggtgtgcaccgtcaccggcaacggcctgaaggacccggacaccgctctgaagggc
atgcccgcggttatcccggtgcccgtcgaccccgtcgccgtcgtcgccaagctcggcctg
gtctag

DBGET integrated database retrieval system