KEGG   Mycobacterium chubuense: Mycch_4196Help
Entry
Mycch_4196        CDS       T02150                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mcb  Mycobacterium chubuense
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mycch_4196
Enzymes [BR:mcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mycch_4196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4403262..4404230)
Genome map
AA seq 322 aa AA seqDB search
MSPRDGNTATEWVPTGSVTVRVPGKVNLYLDVGDRRDDGYHELTTVFHAVSLLDEVTVRT
SDMLTVEVSGEGADSVPTDERNLAWRAAELMAEHVGRAPDVAISIDKTIPVAGGMAGGSA
DAAAVLVAMNTLWELGVPRRDLHALAAELGSDVPFALHGGTALGTGRGEELATVLARNTF
HWVLAFSRGELSTRRVFAEIDRLRASGDRTLPPRLESPEPLLAALASGDPAQLAPLLGND
LQPAALSLDSSLRRTLRAGVEAGALAGIVSGSGPTCAFLCASAGAAVDIGTELAGAGVCR
TVRVASGPVQGARVVPSPSTAG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtctccgcgtgacggcaatacggcaaccgagtgggttcccaccgggtcggtcaccgtc
cgggtgcccggcaaagtcaacctctatctggacgtgggggatcggcgcgacgacggctat
cacgaactgaccaccgtcttccacgccgtgtccctgctcgacgaggtgaccgtccgtacg
tccgacatgctgacggtggaggtgtcgggggagggggccgactcggtgcccaccgacgaa
cgcaacctcgcgtggcgggccgccgagctgatggccgagcacgtgggccgggctcccgac
gtcgcgatctcgatcgacaagacgatcccggtggccgggggaatggcgggcggcagcgcc
gacgccgccgcggtgctggtggccatgaacacgctgtgggaactcggggtgccgcgcagg
gatctgcacgcgctggccgccgagctcggcagcgacgtgccgttcgcgctgcacggcggc
acggcgctgggcaccgggcggggcgaggagctcgcgaccgtcctcgcccgcaacaccttc
cactgggtgctggcattctcccggggcgaactgtccaccaggagggtgttcgccgagatc
gaccggctgcgtgcctccggcgaccgcacgctgccgccacggctggagagccccgagccg
ctcctggccgcgctcgcctcgggcgatccggctcagctggcgcctctgctcggcaacgat
ctgcaacccgccgccctgagcctcgactcgtcgctgcgccggaccctgcgcgccggcgtg
gaggccggcgcgctggccggcatcgtgtccggttcgggtccgacatgtgcgttcctgtgc
gcctcggcgggcgcggccgtcgacatcggcacggagctggccggcgcgggcgtgtgccgg
accgtgcgggtggccagcggcccggtccagggcgctcgcgtcgtcccgagcccctcgacc
gccggctga

DBGET integrated database retrieval system