KEGG   Mycobacterium chubuense: Mycch_4196Help
Entry
Mycch_4196        CDS       T02150                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mcb  Mycobacterium chubuense
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mcb00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4403262..4404230)
Genome map
AA seq 322 aa AA seqDB search
MSPRDGNTATEWVPTGSVTVRVPGKVNLYLDVGDRRDDGYHELTTVFHAVSLLDEVTVRT
SDMLTVEVSGEGADSVPTDERNLAWRAAELMAEHVGRAPDVAISIDKTIPVAGGMAGGSA
DAAAVLVAMNTLWELGVPRRDLHALAAELGSDVPFALHGGTALGTGRGEELATVLARNTF
HWVLAFSRGELSTRRVFAEIDRLRASGDRTLPPRLESPEPLLAALASGDPAQLAPLLGND
LQPAALSLDSSLRRTLRAGVEAGALAGIVSGSGPTCAFLCASAGAAVDIGTELAGAGVCR
TVRVASGPVQGARVVPSPSTAG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgtctccgcgtgacggcaatacggcaaccgagtgggttcccaccgggtcggtcaccgtc
cgggtgcccggcaaagtcaacctctatctggacgtgggggatcggcgcgacgacggctat
cacgaactgaccaccgtcttccacgccgtgtccctgctcgacgaggtgaccgtccgtacg
tccgacatgctgacggtggaggtgtcgggggagggggccgactcggtgcccaccgacgaa
cgcaacctcgcgtggcgggccgccgagctgatggccgagcacgtgggccgggctcccgac
gtcgcgatctcgatcgacaagacgatcccggtggccgggggaatggcgggcggcagcgcc
gacgccgccgcggtgctggtggccatgaacacgctgtgggaactcggggtgccgcgcagg
gatctgcacgcgctggccgccgagctcggcagcgacgtgccgttcgcgctgcacggcggc
acggcgctgggcaccgggcggggcgaggagctcgcgaccgtcctcgcccgcaacaccttc
cactgggtgctggcattctcccggggcgaactgtccaccaggagggtgttcgccgagatc
gaccggctgcgtgcctccggcgaccgcacgctgccgccacggctggagagccccgagccg
ctcctggccgcgctcgcctcgggcgatccggctcagctggcgcctctgctcggcaacgat
ctgcaacccgccgccctgagcctcgactcgtcgctgcgccggaccctgcgcgccggcgtg
gaggccggcgcgctggccggcatcgtgtccggttcgggtccgacatgtgcgttcctgtgc
gcctcggcgggcgcggccgtcgacatcggcacggagctggccggcgcgggcgtgtgccgg
accgtgcgggtggccagcggcccggtccagggcgctcgcgtcgtcccgagcccctcgacc
gccggctga

DBGET integrated database retrieval system