KEGG   Mycobacterium chubuense: Mycch_4265Help
Entry
Mycch_4265        CDS       T02150                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mcb  Mycobacterium chubuense
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mycch_4265
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mycch_4265
   00640 Propanoate metabolism
    Mycch_4265
   00660 C5-Branched dibasic acid metabolism
    Mycch_4265
Enzymes [BR:mcb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mycch_4265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4472859..4474022)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDSAEDAKAIAEEIGRPVMVKAQVKTGGRGKAGGVK
YAATPDDAFSHAQNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGVEIEEVAATKPDRLARIPVDATTGVDETFAREIAEKGHLPAEVLDAAAVTIAKLWEVF
VAEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRHPEHAEFEDRDATDPLELKAKEN
DLNYVKLDGAVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMANGLD
VILNDSQVKSVFVNVFGGITACDAVANGIVKALEILGDEANKPLVVRLDGNNVEEGRRIL
AEANHPLVIQADTMDSGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgagtatcaggcgaaagagctgttcgccaagcacaacgttcccaccacc
cccggacgggtgaccgactccgccgaggacgccaaggccatcgccgaggagatcggccgg
ccggtcatggtcaaggctcaggtcaagaccggcgggcgcggtaaagccggcggcgtgaag
tacgccgcgacgcccgacgacgcgttcagccacgcgcagaacattctcggcctcgacatc
aagggccacgtcgtcaagaagctgttggtggccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctcgaccgcgccaaccgcacctatctcgcgatgtgttcggtcgag
ggcggcgtggagatcgaggaggtcgccgcgaccaagccggaccggctggcccggatcccg
gtcgacgcgaccacgggtgtcgacgagaccttcgctcgcgagatcgccgagaagggccac
ctgcccgccgaggtgctcgacgcggccgcggtgaccatcgccaagctgtgggaggtcttc
gtcgccgaggacgccacgctggtcgaggtgaacccgctcgtccgcacgcccgatgaccag
atcctggcgctcgacggcaaggtcaccctcgacgcgaacgcggacttccgccatcccgag
catgccgagttcgaggaccgcgacgccaccgatccgctcgagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacggcgcggtcggcatcatcggcaacggcgcgggcctg
gtcatgtcgacgctggacgtcgtcgcctacgcgggtgagaagcacggcggcgtcaagccc
gccaacttcctcgacatcggcggcggcgcctcggccgaggtgatggccaacgggctggac
gtcatcctcaacgacagccaggtcaagagcgtgttcgtcaacgtgttcggcggcatcacc
gcctgcgacgcggtggccaacggcatcgtcaaggcgctggagattctgggcgacgaggcg
aacaagccgctggtcgtgcgtctcgacggaaacaacgtcgaggaaggtcggcgcatcctc
gccgaggccaaccatccgctggtcatccaggcggacaccatggactcgggcgccgacaag
gccgccgagctggcgaataagtaa

DBGET integrated database retrieval system