KEGG   Mycobacterium chubuense: Mycch_4577Help
Entry
Mycch_4577        CDS       T02150                                 

Definition
(RefSeq) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mcb  Mycobacterium chubuense
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Mycch_4577
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mycch_4577
   00650 Butanoate metabolism
    Mycch_4577
  Lipid metabolism
   00071 Fatty acid degradation
    Mycch_4577
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mycch_4577
   00310 Lysine degradation
    Mycch_4577
   00360 Phenylalanine metabolism
    Mycch_4577
   00380 Tryptophan metabolism
    Mycch_4577
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mycch_4577
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mycch_4577
   00281 Geraniol degradation
    Mycch_4577
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mycch_4577
   00627 Aminobenzoate degradation
    Mycch_4577
   00930 Caprolactam degradation
    Mycch_4577
Enzymes [BR:mcb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mycch_4577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4813008..4813808
Genome map
AA seq 266 aa AA seqDB search
MSEPDKQPDCLVEQRGHTLIVTMNRPEARNALSGEMLSIMVSAWDRVDDDPEIRTCILTG
AGGYFCAGMDLKAASAKPPGDSFKDGSYDPSRIDGLLKGRRLKKPLIAAVEGPAIAGGTE
ILQGTDIRVAGESAKFGISEAKWSLYPMGGSAVRLVRQIPYTIACDLLLTGRHITAAEAK
EYGLIGYVVPDGTALDKALEIAEVINNNGPLAVQAILKTIRETEGMHEEEAFKPDTANGI
PVFLSEDAKEGPRAFKEKRPPNFQMR
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaacccgacaagcagcccgactgcctcgttgagcagcgcggacacaccctgatc
gtcaccatgaaccgccccgaggcgcgcaacgctctctccggcgagatgctctcgataatg
gtctccgcctgggaccgcgtcgacgacgatccggagatccgcacgtgcatcctgaccggc
gcgggcgggtacttctgcgcggggatggacctcaaggcggcgtcggcgaaaccgccgggt
gactccttcaaggacggcagctacgacccgtcgcgcatcgacgggctgctcaaaggccgg
cggctcaagaagccgctgatcgccgcggtggagggcccggcgatcgccggcggcaccgag
atcctgcagggcaccgatatccgcgtcgccggggagagcgcgaagttcggtatctccgag
gcgaagtggagcctgtacccgatgggcggatcggcggtgcgcctggtgcgccagatcccg
tacacgatcgcgtgcgatctgctgctgaccggacgccacatcacggccgccgaggccaag
gagtacgggctcatcggttacgtcgtgcccgacggcaccgcgctggacaaggcgctcgag
atcgccgaggtcatcaacaacaacggcccgctggcggtgcaggcgatcctcaagaccatc
cgcgagaccgagggcatgcacgaggaagaggcgttcaagcccgacaccgcgaacggtatc
ccggtgttcctgagcgaggacgcgaaggagggcccgcgcgccttcaaggagaagcgcccg
ccgaacttccagatgcgctga

DBGET integrated database retrieval system