KEGG   Mycobacterium chubuense: Mycch_4666Help
Entry
Mycch_4666        CDS       T02150                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mcb  Mycobacterium chubuense
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mycch_4666
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Mycch_4666
Enzymes [BR:mcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Mycch_4666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4911902..4912648)
Genome map
AA seq 248 aa AA seqDB search
MSELGGRAALVTGAASGIGAACARELARRGAAVTIADVDDAAANALAGEIGATAWVVDLS
DVRALEGLRLQTDILVNNAGVQTVSEISEFPPERFRMMMALMVEAPFLLIRAALPHMYGS
GFGRIINISSIHGLRASPFKVAYVTAKHALEGLSKVTALEGGPHGVTSNCVNPGYVRTPL
VTKQIADQARTHGIGEDQVVEEILLKESAIKRLVEPEEVGSLVAWLASSSAGMVTGASYT
MDGGWSAR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaactcggcggccgcgccgccctcgtgacgggcgccgccagcgggatcggtgcg
gcctgtgcgcgggagctggcgcgccgcggtgcggccgtcacgatcgccgacgtcgacgac
gccgcagccaacgcgctggccggggagatcggcgcaaccgcttgggtggtggatctctcc
gacgtcagggcgctggagggactgcggttgcagaccgacatcctggtcaacaacgccggt
gtgcagaccgtcagcgagatctccgagtttccgccggagcgattccggatgatgatggcc
ctgatggtcgaggcgccgttcctgttgatccgtgccgcgttgccacacatgtacggcagt
ggcttcggccggatcatcaacatctcgtcgatccacgggctgcgggcctcgccgttcaag
gtcgcctacgtcaccgccaagcacgcgctggagggcctgtcgaaggtgaccgcgctggag
ggcggaccgcacggggtcaccagcaactgcgtcaaccccggttatgtgcgtacgccgctg
gtgaccaagcagatcgccgatcaggccaggactcacggcatcggtgaggatcaggtggtg
gaggagattctgctcaaggagagcgcgatcaaacgcctcgtcgaaccggaggaggtcggc
tcgctggtcgcttggctggcatcgtcgtcggcgggcatggtgacgggagcctcgtacacg
atggacggaggatggagtgctcggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system