KEGG   Mycobacterium chubuense: Mycch_4721Help
Entry
Mycch_4721        CDS       T02150                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mcb  Mycobacterium chubuense
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mycch_4721
Enzymes [BR:mcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Mycch_4721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4962322..4962930)
Genome map
AA seq 202 aa AA seqDB search
MTRSHNHSATITTPEFDQARAEAAVRELLIAVGEDPDRHGLVDTPARVARAYREIFAGLY
TDPDDVLNTTFDEQHDELVLVKDIPMYSTCEHHLVSFHGVAHVGYIPGHDGRVTGLSKLA
RVVDLYAKRPQVQERLTGQIADALMRKLDPRGAIVVIEAEHLCMAMRGIRKPGATTTTSA
VRGQFKTDKASRAEALDLILRK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggtcgcacaaccattcggccacgatcaccacccccgaattcgaccaggcccgc
gccgaagccgcggtgcgtgagctcctgatcgccgtcggcgaggaccccgaccggcacgga
ctggtggacaccccggcccgggtggcgcgcgcgtaccgcgagatcttcgccggtctctac
accgaccccgacgacgtcctgaacaccaccttcgacgagcagcacgacgaactcgtgctc
gtcaaggacatcccgatgtactcgacgtgcgagcatcacctggtgtccttccacggcgtg
gcgcacgtcggctacatccccggtcacgacggccgagtgacgggcctgtcgaagctggcc
cgcgtcgtcgacctgtacgccaagcgcccccaggtgcaggagcggctgacgggccagatc
gccgatgcgctgatgcgcaagctcgatccgcgcggcgcgatcgtggtgatcgaggccgag
cacctgtgcatggcgatgcggggcatccgtaagcccggcgccaccacgaccacctcggcg
gtgcgcggtcagttcaagaccgacaaggcgtcccgcgcggaggctctggatctgatcctg
agaaagtga

DBGET integrated database retrieval system