KEGG   Mycobacterium chubuense: Mycch_4820Help
Entry
Mycch_4820        CDS       T02150                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mcb  Mycobacterium chubuense
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mcb00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5058977..5060494)
Genome map
AA seq 505 aa AA seqDB search
MAEFVAAIDQGTTSTRCMIFNHDGAEVGRHQLEHEQILPKAGWVEHNPVEIWERTGAVLA
TALNTTKLTTADLAALGITNQRETSLVWNRRTGRPYYNAIVWQDTRTDRIASALDRDGRG
DVIRQKAGLPPATYFAGGKLAWLLENVDGLRADAEKGEALFGTTDTWVLWNLTGGHRGGV
HVTDVTNASRTMLMNLETLDWDDELLSFFGVPREMLPEIRPSSCSEPYGTTLETGPADGE
LPITGILGDQQAAMVGQVCLGKGEAKNTYGTGNFLLLNTGEEIVRSQNGLLTTVCYQFDD
AKPVYALEGSIAVTGSAVQWLRDQLGIISGASQSEALARQVEDNGGVYFVPAFSGLFAPY
WRSDARGAIVGLSRFNSNAHVARATLEAICYQSRDVVDAMEADSGVHLEVLKVDGGVTAN
DLCMQIQSDVLGVDVVRPVVAETTALGAAYAAGLGVGFWEGPEDLRANWQEDKRWTPNWS
QEQRAEGYAGWQKAVQRTMDWVDVN
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
gtggccgagttcgtcgcagccatcgaccagggcaccaccagcacccggtgcatgatcttc
aaccacgacggcgccgaagtcggccgccaccaactcgagcacgaacagatcctgcccaaa
gcgggctgggtggaacacaatccggtcgagatctgggagcgcaccggggcggtgctggcg
accgcgctgaacacgacgaagctgacgacggccgatctggcggcgctgggcatcaccaac
cagcgcgagacgtcgctggtgtggaaccgccgcaccgggcgcccgtactacaacgcgatc
gtctggcaggacacccgtaccgaccgcatcgcctcggcgctcgaccgggacggccgcggc
gacgtcatccggcagaaggccgggctgccgccggccacctacttcgccggcggcaagctg
gcgtggctgctggagaacgtcgacgggctgcgcgccgacgcggagaagggcgaggcgctc
ttcggcaccaccgacacgtgggtgttgtggaacctcaccggcgggcaccgcggcggcgtg
cacgtcaccgacgtcaccaacgccagccgcaccatgctgatgaacctcgagacgctcgac
tgggacgacgagctgttgtcgttcttcggcgttccgcgcgagatgctgcccgagatccgg
ccgtcgtcgtgctcggagccgtacggcacgacgctcgagaccggtccggcggacggcgaa
ctgccgatcaccggcatcctgggagaccagcaggccgcgatggtcgggcaggtgtgcctg
ggcaagggtgaggccaagaacacctacggcacaggcaatttcctgttgctcaacaccggc
gaggagatcgtgcgctcgcagaacgggttgctgaccacggtgtgctaccagttcgatgac
gcgaagccggtgtacgcgctcgagggttcgatcgcggtgacgggctcggcggtgcagtgg
ctgcgcgaccaactgggcatcatcagcggcgcgtcgcagagtgaggcgctggcgcgtcag
gtcgaggacaacggcggggtgtacttcgtgccggcgttctccgggctgttcgcgccgtac
tggcgatcggacgcccgcggcgcgatcgtcgggctgtcgcggttcaacagcaacgcccac
gtggcccgcgcgacgctggaggcgatctgctaccagagccgcgacgtcgtcgacgcaatg
gaggccgactccggggtgcacctggaggtgctcaaggtcgacggcggtgtcacggccaac
gacctgtgcatgcagatccagtccgacgtgctgggcgtcgacgtcgtccggccggtcgtc
gccgagaccacggcgctgggcgcggcgtacgccgccgggttgggcgtcgggttctgggag
ggacccgaggatctgcgcgccaactggcaggaggacaagcgctggacaccgaactggtcc
caggagcagcgcgccgagggttacgccggctggcagaaggccgtgcagcgcacgatggac
tgggtcgacgtcaactga

DBGET integrated database retrieval system