KEGG   Mycobacterium chubuense: Mycch_5074Help
Entry
Mycch_5074        CDS       T02150                                 

Definition
nicotinamidase-like amidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mcb  Mycobacterium chubuense
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mycch_5074
Enzymes [BR:mcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mycch_5074
    3.5.1.-  
     Mycch_5074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5323968..5324540
Genome map
AA seq 190 aa AA seqDB search
MTDPSEMSGKALVIVDVQNDFCEGGSLAVTGGAAVARRINDWLSRTRYDHVVATKDFHID
PGGHFSDHPDFVDSWPPHCVVGSPGAEFHPDLDTGPIEAVFTKGRYTAAYSGFEGATDDG
TPLADWLRAHGVDSVDVVGIATDYCVKATAADAAAAGLTTRVLLDLTAGVSPATTAQAVE
SLRAAGVRCD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacccctccgagatgtccggcaaggcgctcgtcatcgtcgacgtgcagaacgac
ttctgcgagggtggctcactggcggtgaccggcggcgcggccgtcgcccgccggatcaac
gattggctctcccgcacgcgctacgaccacgtggtggccaccaaggacttccacatcgac
ccgggcgggcacttctccgaccaccccgacttcgtcgactcctggccgccgcactgtgtc
gtcggatctcccggcgcggagttccacccggacctcgacaccggcccgatcgaggccgtg
ttcacgaagggccggtacacggcggcctacagcggcttcgagggggcgaccgacgacggc
accccgctggccgactggctgcgggcgcacggcgtcgactcggtggacgtggtcggtatc
gcgaccgactactgcgtgaaggcgaccgccgcggacgcggccgccgcaggattgaccaca
cgggtcctgctcgacctgaccgccggggtgtcgccggcgaccaccgcgcaggccgtcgag
tcactgcgggccgccggcgtcaggtgtgactga

DBGET integrated database retrieval system