KEGG   Mycobacterium chubuense: Mycch_5237Help
Entry
Mycch_5237        CDS       T02150                                 

Definition
cellobiohydrolase A (1,4-beta-cellobiosidase A)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mcb  Mycobacterium chubuense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mcb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5484284..5485285)
Genome map
AA seq 333 aa AA seqDB search
MSSAAGAVARWIAPVLTLAAIAAVGLAAHSAPAGPSPAVRLVDEVNPLAGAPFYVNPASA
AMRAAQSADPPSPQLAAVANTPQAYWLVPGSSAATVASYTAAAQAAGAIPILTIYGIPHR
DCGSFAAGGMASGADYRSWIDGIAADLGASRAAVVVEPDALAMADCLSADQRQERFDLIR
YAVDALTRDPAAAVYIDAGHLRWHSPEDMAGRLNQAGIEHARGFSLNTANFFTTEDEIGY
GEAISGLTNGKHYVVDTSRNGAGPAPDSALNWCNPGGRALGTPPTAATAGPHADAYLWIK
RPGESDGTCDKGDPPAGTFVNQYAIELARNAGQ
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcagctgccggcgcggtcgcccggtggatcgctcccgtcctgacgcttgcggcg
atcgccgcggtgggcttggccgcccactcggcaccggccgggccgtccccggcggtgcgc
ctggtcgacgaggtcaacccgttggccggagcacccttctacgtcaaccccgcatcggcg
gccatgcgtgccgcgcagagcgccgatccgcccagtccgcaattggccgcggtcgccaac
acgccgcaggcctactggctcgtcccgggctcgtcggcggcgacggtcgcgagttacacc
gccgcggcgcaggcggccggcgccattccgatcctcacgatctacgggatcccccaccgg
gactgcggcagcttcgccgcaggcggcatggcctcgggtgcggactaccggagctggatc
gacggcatcgctgccgatctgggcgcgtcgcgcgcagcggtcgtcgtggaaccggatgcg
ctcgccatggccgactgcctgtcggccgatcaacgccaggaacgcttcgatctgatccgc
tacgccgtcgacgcgctgacccgcgacccggcagcggccgtgtacatcgacgccggtcac
ctccgctggcacagtccggaagacatggccggcaggctcaatcaggccgggatcgaacac
gcccgcggcttcagcctcaacaccgcgaacttcttcaccaccgaggacgagatcggctac
ggcgaggcgatctcggggctgacgaacggcaagcactacgtggtggacacgtcgcgcaac
ggtgccgggccggctccggactccgcgctgaactggtgcaacccgggcgggcgggctctg
gggactccgccgaccgcggccaccgcgggtccgcacgccgacgcgtacctgtggatcaaa
cgtcccggcgaatccgacggcacctgcgacaagggtgacccgccggcgggcaccttcgtc
aaccagtacgccatcgagctggcccgcaacgcggggcagtag

DBGET integrated database retrieval system