KEGG   Mycobacterium chubuense: Mycch_5293Help
Entry
Mycch_5293        CDS       T02150                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mcb  Mycobacterium chubuense
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mycch_5293
Enzymes [BR:mcb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mycch_5293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5542835..5543809
Genome map
AA seq 324 aa AA seqDB search
MPSVSNTSATTPVGPLDGLVVPRYAGHSTFARLPRIEDVPSCDVAVVGVPFDTGVTYRPG
ARFGPSHIRQASRLLRPYNPALDVSPFAHGQVVDAGDLAVNPFDIASAVASIESGAHELI
AGGAKVIALGGDHTIAYPLLKAVNRVHGPVALVHFDAHLDTWDTYFDAPLTHGTPFRRAA
EDGLFIQGHSAHVGIRGSLYSSQDLSSDADLGFHIVHCREFARRPIDDVIAGLRQRIGDA
PLYVSIDIDVLDPAHAPATGTPEAGGMTSRELLEIVRGFDGLNLVGADIVEVSPAYDHAE
ITGVAAANLAYEFVSLFARQAAQR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtgtgagcaacacatccgccaccacgcccgtcggcccgctcgacggcctggtc
gtgccccggtacgccgggcactccaccttcgcacgcctgccgcgcatcgaagacgtgccg
tcctgcgacgtcgccgtcgtcggcgtcccgttcgacaccggcgtcacctaccggcccgga
gcgcggttcgggccctcgcacatccggcaggcatcgcggctgctgcggccgtacaacccg
gcactggacgtctcgccgttcgcgcacggtcaggtggtcgacgccggcgacctcgcggtg
aacccgttcgacatcgccagcgcggtcgcctccatcgaaagcggcgcacacgagttgatc
gccggcggcgccaaggtgatcgccctcggcggggaccacaccatcgcctatccgttgctc
aaggcggtcaaccgggtgcacgggccggtcgcgctcgtgcacttcgacgcccatctcgac
acatgggacacgtatttcgacgccccgctcacccacggcacgcccttccggcgcgccgcc
gaggacggcctgttcatccagggccacagtgcgcacgtcggcatccgcgggtcgctgtac
tcgtcgcaagacctgtcgtccgacgccgacctcggcttccacatcgtgcactgccgcgag
ttcgcgcgacgcccgatcgacgacgtcatcgcgggcctccgccagcggatcggggacgca
ccgctgtacgtgtccatcgacatcgacgtcctcgaccccgcgcacgctccggcgaccggg
acgcccgaagccggcgggatgaccagccgcgaactgctcgagatcgtgcgcgggttcgac
gggctcaacctcgtcggcgccgacatcgtcgaagtctcgccggcctacgaccacgccgag
atcaccggggtcgcggcggcgaacctcgcctacgaattcgtctcactgttcgcccggcag
gccgcgcagcgatga

DBGET integrated database retrieval system