KEGG   Mycobacterium chubuense: Mycch_5449Help
Entry
Mycch_5449        CDS       T02150                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase (EC:4.4.1.15)
Organism
mcb  Mycobacterium chubuense
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMYCCH.01:complement(111776..112750)
Genome map
AA seq 324 aa AA seqDB search
MNRLLGLPRVPLATLPTPLHPAPRLSEAIGVEVWLKRDDLTGLGLGGNKVRGLEYLIGDA
LAQGCDCLVTGAGPQSNWAMLSALAARRCGLDPHLVFYGSPVSPTGNLLLDELIGAEVHY
TGEPDRTSVDAGIEALAEKLRAAGRRPYILPRGGATALGSAGYLRASLELAGQLVDACLA
PAQLWLASGSCGTQAGLVAGARWLRTPYEVIGVSVSRPEEECTHRVRALAEDAAELLGLP
GNDPTGTAEDVTVLGGHIGPGYGKPSEEGAAAAELVARTEGVFLDPVFAAKAMGALLRSA
PAGPVVFLVSGGTPTLFAARKESM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggctgttggggctgccccgcgtcccgctggccaccctgcccaccccattgcac
cccgctccccggttgtccgaggccatcggggtcgaggtgtggctcaagcgcgacgacctc
accgggcttggcttgggcggcaacaaggtgcgtggcctggaatacctgatcggcgacgct
ctcgcccagggctgcgattgcctggttaccggggcgggcccgcagtcgaactgggcgatg
ctgtctgcgctcgccgcgcgtcgttgcgggctcgatccgcacctggtgttctacggctcg
cccgtgtcgcccaccggcaacctgctgctcgacgagctgatcggcgccgaggtgcactac
accggcgaacccgaccgcacctcggttgacgccgggatcgaggccctcgccgagaagctg
cgcgcggccggtcgccgcccgtacatcctgccccgcgggggcgcgaccgccctgggctcg
gccggttacctacgggcgagcctggaactggccgggcaactggtagacgcctgcctcgct
cccgcccagctgtggctggcctccggctcctgcggcacgcaggctggcctggtcgcggga
gcccgctggctgcggacgccgtatgaggttatcggggttagcgtgagccgtccggaggag
gaatgcacccaccgggtcagggccctcgccgaggatgctgccgagctgctcgggctcccc
ggcaacgacccgaccggcacggcggaggacgtgaccgtgcttggcggccacatcggtccg
ggctacgggaagccgtcggaagaaggtgctgccgcggccgaactggttgcgcgcaccgag
ggcgtgttcctggatccggtgtttgccgccaaggcgatgggcgcgctgctgcggagtgcg
cccgccggcccggtggtattcctggtcagcggtggcacacccacgctgttcgcggcccgg
aaggagtcgatgtga

DBGET integrated database retrieval system