KEGG   Mycobacterium chubuense: Mycch_5963Help
Entry
Mycch_5963        CDS       T02150                                 

Definition
(RefSeq) 1-aminocyclopropane-1-carboxylate deaminase (EC:4.4.1.15)
  KO
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
mcb  Mycobacterium chubuense
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:mcb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mycch_5963
Enzymes [BR:mcb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Mycch_5963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pMYCCH.02:complement(17361..18368)
Genome map
AA seq 335 aa AA seqDB search
MNRTYLMADVVDVGTAPLPRVAFVREPTPLHQAARLSDALGVEVWFKRDDLTGIGLGGNK
LRGLEYLIADALTQGCDSLVTGAGPQSNWAMLAALTARQVGIEPYLVHYGPPTVATGNLL
LIDLIKVDRRFTGSPDRTSVDDEMVRLCNNLVASGRKPYAIPRGGASSRGAAGYVRAGIE
LDHQWREFGAAPSQIWLPTGSCTTHAGLVTAARWLGWSAEIVGVTVSRPSGECTERIEEI
SASCASLLDITTPADRPIQVIDGYIGPGYGIASPAGNAAAALVAELEGIFLDPLFGAKAM
AALIDAAHEGRVSGPVVFLATGGAPTLFAAGKVFV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
ttgaaccgaacttacctaatggctgacgttgtagatgtcggcaccgcgccactcccgcgg
gttgccttcgtccgcgagcccacgccacttcatcaggctgcgcgcctgtctgacgcactc
ggtgtcgaagtctggttcaaacgcgatgacctgaccggcattggccttggcggaaataaa
cttcggggtcttgagtacttgatcgctgacgcactcacccagggctgcgacagcctggtg
accggagccgggccccaatcaaattgggccatgttggccgcattgactgcacggcaggtc
gggatcgagccctatctagttcactacggcccacctacagttgcgaccggaaacctgctg
ctgattgatctgatcaaggtcgatcggcgcttcacgggcagtcccgaccgcacctcggtg
gacgacgagatggtccgcttgtgcaataacctagttgcatccggacgcaagccgtacgcc
atcccacggggtggcgccagtagccgcggtgctgccggatatgtacgtgctggtatcgaa
ttggaccaccagtggcgtgaattcggggcggcaccgtcacagatttggttgccgacagga
tcgtgcacaacccatgcgggcctcgtcaccgccgcgcgctggctaggatggtcagcggag
attgtcggggtcactgtcagtcgaccgagcggcgagtgcactgagcgcatcgaagaaatc
tcggcgtcttgcgcctcccttctggacatcacaacgccggctgatcgccctatccaagtg
attgacggttacatcgggcccggctacgggatcgcctccccagcgggtaacgcagcggcc
gccctcgtggctgaactcgaagggatctttctggatccgctcttcggcgcgaaggcaatg
gcggcactcatcgatgcagcacatgagggccgtgtgagcggaccagttgtgttccttgca
actggaggtgcaccgacactgttcgccgccggaaaggtattcgtatga

DBGET integrated database retrieval system