KEGG   Macaca mulatta (rhesus monkey): 100144394Help
Entry
100144394         CDS       T01028                                 

Gene name
CYP3A7
Definition
cytochrome P450, family 3, subfamily A, polypeptide 7 (EC:1.14.14.1)
Orthology
K17691  
cytochrome P450, family 3, subfamily A, polypeptide 7 [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Steroid hormone biosynthesis
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100144394 (CYP3A7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100144394 (CYP3A7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100144394 (CYP3A7)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100144394 (CYP3A7)
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP3 family
   100144394 (CYP3A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 503 aa AA seqDB search
MDLIPDLAVETWLPLAVSLILLYLYGTHSHGLFKKLGIPGPTPLPFFGNVLSFRKGFWTF
DMECYKKYRKVWGFYDCRQPVLAITDPNMIKTVLVKECYSVFTNRRPLGPVGFMKSAITV
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRREAETGKPVTLKDVFGAYS
MDVITSTSFGVNVDSLNNPQDPFVENTKKLLRFNSLDPFFLSIKIFPFLTPIFEALNITV
FPRKVTSFLRKSVKRMKEGRLKETQKRRVDFLQLMIDSQNSKDTESHKVLSDLELMAQSI
MFIFAGYETTSSVLSFIIYELATHPDVQQKLQKEIDTVLPNKAPPTYDTMLQMEYLDMVV
NETLRLFPVAMRLERVCKKDVEINGMSIPKGVVVMIPSYVLHHDPKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGNGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSFG
GLLKTEKPIVLTAESRDGTVSGA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctcatcccagacttggccgtggaaacctggcttcccctggctgtcagcctgata
ctcctctatctatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctctgccttttttcggaaatgttttgtctttccgtaagggcttttggacgttt
gacatggaatgttataaaaagtacagaaaagtctggggtttttatgactgtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggcctttaggtccagtgggatttatgaaaagtgccatcactgta
gctgaggatgaagaatggaagagaatacggtcattgctctctccaactttcaccagtgga
aaactcaaagagatggtccctatcattgcccagtatggagacgtgctggtgagaaatctg
aggcgggaagcagagacaggcaagcctgtcaccttgaaggacgtctttggggcctacagc
atggatgtgatcactagcacatcatttggagtgaacgtcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagattcaattcattagatcctttcttt
ctctcaataaaaatctttccattccttaccccaatttttgaagcattaaatatcactgtg
tttccaagaaaagttacaagttttctaagaaaatctgtaaagaggatgaaagaaggtcgc
ctcaaagagacacaaaagcgccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagacactgagtcccacaaagttctgtctgatctggagctcatggcccaatcaatt
atgtttatttttgctggctatgaaaccacgagcagtgttctctccttcattatatatgag
ctggccactcaccctgatgtccagcagaaactgcagaaggaaattgatacagttttaccc
aataaggcaccacccacctatgatactatgctacagatggagtatctcgacatggtggtg
aatgaaacgctcagattattcccagttgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatgtccattcccaaaggggtggtggtgatgattccaagctatgtt
cttcatcatgacccaaagtactggacagagcctgagaagttcctccctgaaaggttcagt
aagaagaacaaggacaacatagatccttacatatacacgccctttggaaatggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccctgtaaagaaacacagatccccctgaaattgagctttgga
ggacttcttaaaacagaaaaacccattgttctaacggctgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system