KEGG   Macaca mulatta (rhesus monkey): 100270703Help
Entry
100270703         CDS       T01028                                 

Gene name
USP9X, USP9Y
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 2545 aa AA seqDB search
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNP
HCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPKGWLVDLLNKFGTLNGFQILHDR
FINGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLATYMESMRLYARDHEDYDPQTVRLGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
SNDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSV
NCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFVVRFPNQGRQVD
DLEVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVGGELIDPADDRKLIGQLNLKDKSL
ITAKLTQISSNMPSSPDXXXXXXXLNYCINFDGYNNSSHSSIMSLHPRYISFLWQVADLG
SSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLFFGPSASQV
LYLTEVVYALLMPAGAPLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNADMETRRGAY
LNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTPINQVTHDQAVVLQSALQSIPNP
SSECMLRNVSVRLAQQISDEASRYMPDICVIRAIQKIIWASGCGSLQLVFSPNEEITKIY
EKTNAGNEPDLEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLLLHCHSKTV
RQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLRHLLNYAYN
SNINVPNAEVLLNNEIDWLKRIRDDVKRTGETGIEETILEGHLGVTKELLAFQTSEKKFH
IGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPPTINAGFELLVAL
AVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLKNAGATCYM
NSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGYPQQFEDKP
ALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNLREQHDALE
FFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTLNVDIRNHQ
NLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRFDYDWEREC
AIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQSEQSESETAGSTKYRLVGV
LVHSGQASGGHYYSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKNQCFGGEYMGE
VFDHMMKRMSYRRQKRWWNAYILFYERMDTIDQDDELIRYISELAITTRPHQIIMPSAIE
RSVRKQNVQFMHNRMQYSMEYFQFMKKLLTCNGVYLNPPPGQDHLLPEAEEITMISIQLA
ARFLFTTGFHTKKVVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRFSEYLLECP
SAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAVLNLLRREV
SEHGRHLQQYFNLFVMYANLGVAEKTQLLKLSVPATFMLVSLDEGPGPPIKYQYAELGKL
YSAGLSNPPLPNPFGDPNLSQPIMPIQQNVADILFVRTSYVKKIIEDCSNSDETVKLLRF
CCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLLLQILLIEDSWQTHRIHNALKGIPDD
RDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPVAYQILQGNGDLKRKWTWAVEWLGDE
LERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERSHSARMTLAKACELCPEEVKKATSVQ
QIEMEESKEPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQNNHVHGQPYTGPAAHHMNNP
QRTGQRAQENYEGSEEVSPPQAKDQ
NT seq 7638 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccggtcggagggaatgacaaccagggccaggctcct
gatggacagtctcagccccccctccaacaaaatcagacttcatcgcctgattcttccaat
gaaaattccccggcaactcccccagatgagcaaggtcaaggtgatgccccaccacagctt
gaagatgaggaacctgcatttccacatactgacttggccaagttggatgacatgatcaac
aggcctcgatgggtggttccagttttgccaaaaggggaattagaagtgcttttagaagct
gctattgatcttagtaaaaaaggccttgatgttaaaagtgaagcatgtcagcgatttttc
cgagatgggctaacaatatcattcactaaaatccttacagatgaagcagtgagtggctgg
aagttcgaaattcataggtgtattattaacaatactcatcgtctggtggagctatgtgtg
gccaagttgtcccaagactggtttccacttttagaacttcttgccatggccttaaatcct
cattgcaaattccatatctacaatggtacacgtccatgtgaatcagtttcctcaagtgtt
cagttgcctgaagatgaactctttgctcgttctccagaccctcgatcaccaaagggttgg
ctagtggatcttctcaacaaatttggcactttaaatgggttccagattttgcatgatcgt
tttattaatggatcagcattaaacgttcaaataattgcagcccttattaaaccatttggg
caatgctatgagtttctcactcttcatacagtgaaaaagtactttcttccaataatagaa
atggttccacagtttttagaaaacttaactgatgaagaactgaaaaaggaagcaaagaat
gaagccaaaaatgatgctctttcaatgattattaaatctttgaagaatttagcttcaagg
gtaccaggacaagaagaaactgttaaaaacttagaaatatttaggttaaaaatgatactt
agattattgcaaatttcttctttcaatggaaagatgaatgccctgaatgaagttaataag
gtgatatctagtgtgtcatactatacccatcgacatggtaatcctgaggaggaagagtgg
ctcacagctgaacgaatggcagaatggatacagcagaacaatatcttatccatagtgttg
cgagatagtcttcatcagccacaatatgtagaaaagttggagaagattcttcgttttgtc
atcaaagaaaaagctctgaccttacaggaccttgataatatctgggcagcacaggcaggg
aaacatgaagccattgtgaagaatgtacatgatctcctggcaaaattggcatgggatttt
tctcctgaacaacttgatcatctttttgattgttttaaggccagttggacaaatgcgagt
aaaaagcaacgtgaaaagctacttgagctgatacgtcgtcttgcagaagatgataaagat
ggtgtgatggcacacaaagtgttgaaccttctgtggaatctagctcacagtgatgatgtg
cctgtagatatcatggacctggctctcagtgcccacataaaaatactagattacagttgc
tcccaggaccgtgatacacaaaagatccaatggatagatcgctttatagaagaacttcgc
acaaatgacaaatgggttattcccgccctgaaacagattagagaaatttgtagtttgttt
ggtgaagcgcctcaaaatttgagtcaaactcagcgaagtccccatgtgttttatcgccat
gacttaatcaatcaacttcaacacaatcatgccctagttactttggtagcagaaaacctt
gcaacttacatggaaagcatgagactatatgctagagaccatgaagattatgacccacaa
actgtgaggctgggaagtagatacagtcacgttcaagaagttcaagaacggcttaacttc
cttagatttttattgaaggatggccaactgtggctatgtgctcctcaggcaaaacaaata
tggaaatgcttagctgagaatgcagtttacctttgtgatcgtgaagcctgttttaagtgg
tattccaaattgatgggggatgaaccagacttagatcctgatattaataaggacttcttt
gaaagtaatgtgcttcagcttgatccttctctgttaactgaaaatggaatgaagtgtttt
gagcgattcttcaaagctgtgaattgtcgagaaggaaaactagtagcaaaaaggagagcc
tatatgatggatgacttggagttaataggattagattacctttggagggtcgtgattcag
agtaatgatgatattgccagcagagctatagatctcctcaaagagatatacacaaacctt
ggtccaagactacaagtcaatcaggtggtgatccatgaagacttcattcagtcttgtttt
gatcgtctgaaggcttcctatgacacgttgtgtgttttggatggtgacaaagacagtgtt
aattgtgcaagacaggaagctgttcgaatggttcgagtattaactgttttaagggaatat
ataaatgaatgtgacagtgattatcatgaggaaagaacaattctccctatgtcgagagca
ttccgtggtaaacacctctcttttgtagttcgatttccaaaccagggcagacaggttgat
gacttggaggtatggtctcataccaatgatacaattggttcagtacgacgatgtattctc
aatcgtattaaagccaacgtagcccacacaaaaattgagctctttgtgggcggtgagctg
atagatcctgcagatgatagaaagttgattggacaattaaacttaaaagataaatcgctt
attacagccaaacttacacaaataagttccaatatgccttcaagccctgatannnnnnnn
nnnnnnnnnnnnttgaactactgtataaattttgatggttacaataacagcagccactcc
agtataatgtcactgcatcccagatacatctctttcctttggcaagttgcagacttaggt
agcagcctaaatatgccaccgcttagagatggagcaagagtacttatgaaacttatgccg
ccagatagcacaacgatagaaaaattaagagctatttgtttagaccatgccaaacttggg
gaaagcagccttagtccatctcttgactcgcttttctttggtccttcagcctcacaagtg
ctatatctaacagaggtagtctatgccttgttaatgcctgctggtgcacctctggctgat
gattcctctgattttcagtttcacttcttgaaaagtggtggcctaccccttgtactgagt
atgctaaccagaaataacttcctaccaaatgcagatatggagactcgaaggggtgcctac
ctcaatgctcttaaaatagccaagcttttgctaactgccattggctatggtcacgttcgt
gctgtggcagaagcttgtcagccaggtgtagaaggtgtgaatcccatgacaccgatcaac
caagttacccatgatcaagcagtggtgctacaaagtgcccttcagagcattcctaatcca
tcatccgagtgcatgcttagaaatgtgtcagttcgtcttgctcagcagatatctgatgag
gcttcaagatatatgcctgatatttgtgtaattagagctatacaaaaaattatctgggca
tcaggatgtgggtcgctacagctagtatttagcccaaatgaagaaatcactaaaatttat
gagaagaccaatgcaggcaatgagccggacttggaagacgaacaggtttgctgtgaagca
ttggaagtgatgaccttatgttttgccttgattccaacagccttagatgctcttagtaaa
gaaaaggcttggcagacattcatcattgacttactattgcactgtcacagcaaaactgtt
cgtcaggtggcacaggagcagttctttttaatgtgcaccagatgttgtatgggacaccgg
cctctacttttcttcattactctactctttactgttttggggagcacagcaagagagaga
gctaaacattcaggcgactactttactcttttaagacaccttcttaattatgcttacaat
agtaatattaatgtacccaatgctgaagttcttctcaataatgaaattgattggcttaaa
agaattagggatgatgttaaaagaacaggagaaacgggtattgaagagaccatcttagag
ggccaccttggagtgacaaaggagttactggcctttcaaacttctgagaaaaaatttcat
attggttgtgaaaaaggaggtgctaatctcattaaagaattaattgacgatttcatattt
cctgcatccaatgtttacctacagtatatgagaaatggagagctcccagctgaacaggct
attccagtctgtggttcaccacctacaattaatgctggttttgaattacttgtagcatta
gctgttggctgtgtgaggaatctcaaacaaatagtagattctttgactgaaatgtattac
attggcacagcaataactacttgtgaagcacttactgagtgggaatatctgccacctgtt
ggaccccgcccacccaaaggattcgtggggctgaaaaatgccggtgctacttgttacatg
aattctgtgattcagcaactctacatgattccttccattaggaatggtattcttgccatt
gaaggcacaggtagtgatgtagatgatgatatgtctggagatgagaagcaagacaatgag
agcaatgttgatcccagggatgatgtatttggatatcctcaacaatttgaagataaacca
gcattaagtaaaactgaagatagaaaagagtacaacattggtgtcctaagacaccttcag
gtcatctttggtcatttagctgcttctcgactgcaatactatgtgcccagaggattttgg
aaacagttcaggctttggggtgagcctgttaatctgcgtgaacaacacgatgctttagaa
ttttttaattcattggtggatagtttagatgaagctttaaaagctttaggacatccagct
atgctaagtaaagtcttaggaggttcctttgctgatcagaagatctgccaaggctgccca
cataggtacgaatgtgaagaatcttttacgaccctaaacgtagacattagaaatcaccaa
aatcttcttgattctttggaacaatatgtcaaaggagatttactagaaggtgcaaatgca
tatcattgtgaaaaatgcaataaaaaggttgataccgtaaagcgcttgctgattaaaaag
ttacctcctgttcttgctatacaactaaagcgatttgactatgactgggaaagagaatgt
gcaatcaagttcaatgattattttgaatttcctcgagagctggacatggaaccttacaca
gttgcaggtgtcgcaaagctggaaggggataatgtaaacccagagagtcagttgatacaa
cagagtgagcagtctgaaagtgagacagcaggaagcacaaaatacagacttgtgggtgtg
cttgtacacagtggtcaagcgagtggggggcattattattcttatatcatccaaaggaat
ggtggagatggtgagagaaaccgctggtataaatttgatgatggtgatgtaacagaatgt
aaaatggatgatgatgaagaaatgaaaaaccaatgttttggtggagagtacatgggagaa
gtgtttgatcacatgatgaagcgcatgtcatacaggcgccagaaaaggtggtggaatgct
tatatacttttttacgaacgaatggacacaatagaccaagatgatgagttgataagatac
atatcagagcttgctatcaccaccagacctcatcagattattatgccatcagccattgag
agaagtgtacggaaacagaatgtacaattcatgcataaccgaatgcagtacagtatggag
tattttcagtttatgaaaaaactgcttacatgtaatggcgtttacttaaaccctcctccc
gggcaagatcacctgttgcctgaagcagaagaaatcactatgatcagtattcaacttgct
gctaggttcctctttactacaggatttcacacaaagaaagtagtccgtggctctgccagt
gattggtatgatgcattgtgtatcctccttcgtcacagcaagaatgtacgtttttggttt
gctcataatgtcctttttaatgtttcaaatcgcttctccgaataccttctggagtgccct
agtgcagaagtgaggggtgcgtttgcaaaacttatagtctttattgcacatttttccttg
caagatgggccatgtccttcaccttttgcctctcctggaccttctagtcaggcttatgac
aacttaagcttgagtgatcacttactaagagcagtactaaatctcttgagaagggaagtt
tcagagcatgggcgtcatttacagcagtatttcaacctgtttgtaatgtatgccaattta
ggtgtggcagagaagacacagcttctgaaattgagtgtacctgctacctttatgcttgtg
tctttagatgaaggtccaggtcctccaatcaaatatcagtatgctgaattaggcaaatta
tactcagctgggctcagtaatcctcctcttcccaatccttttggtgatcctaatttatca
caacctataatgccaattcagcagaatgtggcagacattttatttgtgagaacaagttat
gtgaagaaaatcattgaagactgcagtaattcagacgaaaccgtcaaattgcttcgtttt
tgctgctgggagaatcctcagttctcatctactgtcctcagtgaacttctctggcaggtt
gcatattcctatacctatgaactgcgaccctatctggatctgcttttgcaaatcttactg
attgaggactcctggcaaactcacagaattcataatgcactgaaaggaattccagatgac
cgagatgggctgtttgacacaatccaacgctctaagaatcactatcaaaaaagagcatac
cagtgtataaaatgtatggtagctctatttagtaactgtcctgttgcttaccaaatcctg
cagggcaatggagatcttaaaagaaagtggacctgggcggtagaatggcttggagatgaa
cttgaaagaagaccatatactggcaatccacagtacacttacaacaattggtctccccca
gtgcaaagcaatgaaacatcaaatggttatttcttggagagatcacatagtgctaggatg
acacttgcaaaagcttgtgaactctgtccagaggaggtaaaaaaagccaccagtgtgcag
cagatagaaatggaagagagcaaagagccagatgaccaagatgccccagatgaacatgag
tcgcctccacctgaagatgccccattgtacccccattcacctggatctcagtatcaacag
aataaccatgtgcatggacagccatatacaggcccagcagcacatcacatgaacaaccct
cagagaactggccaacgagcacaagaaaattatgaaggcagtgaagaagtatccccacct
caagccaaggatcaatga

DBGET integrated database retrieval system