KEGG   Macaca mulatta (rhesus monkey): 100424030Help
Entry
100424030         CDS       T01028                                 

Gene name
ART3
Definition
ADP-ribosyltransferase 3
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100424030 (ART3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 385 aa AA seqDB search
MKTGHFEIVTMLLATMILVDIFQVKAEVLDMADNAFDDEYLKCTDRMEIKYVPQLLKEEK
ASHQQLDTVWENAKAKWAARKTQIFLPVNFKDNHGIALMAYISEAQEQTPFYHLFSEAVK
MAGQSREDYIYGFQFKAFHFYLTRALQLLRRPCEANSKNVVYRTSQGTSFTFGGLNQARF
GHFTLAYSVKPQAADDQLTVLSIYTCLGVDIEKFLDKESERITLIPLNEVFQVLQEGAGN
NLILQSTNKTCSHYECAFLGGLKTENCVENLEYFQPVYVYNPGEKTQKLEDHAYFCDSGE
KNQKLEDRGVKILEPTEIPGMKIPEPFPVPEDKSQGNINNPTPGPVPVPGPKSHPSASLG
KMLLPEFGMVIILISVSAINLFVAL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaagacaggacattttgaaatagtcaccatgctgctggcaaccatgattctagtggac
attttccaggtgaaggctgaagtgttagacatggcagataatgcatttgatgatgaatac
ctgaaatgtactgacaggatggaaattaaatacgttcctcaactgctaaaggaggaaaaa
gcaagccaccagcaattagatactgtgtgggaaaatgcaaaagccaaatgggcagcccga
aagactcaaatctttctccctgtgaattttaaggataaccatggaatagccctgatggca
tatatttccgaagctcaagagcaaactcccttttaccatctgttcagtgaagctgtgaag
atggctgggcaatctcgagaagattatatctatggcttccagttcaaagctttccacttt
tacctgacaagagccctgcagttgctgagaagaccttgtgaggccaattccaaaaatgtg
gtatatagaacaagccagggcacttcatttacatttggagggctaaaccaagccaggttt
ggccattttaccttggcatattcagtcaaacctcaggctgctgatgaccagctcactgtg
ttatccatctacacatgccttggagttgacattgaaaaatttcttgataaagaaagtgaa
agaattactttaatacctctgaatgaggtttttcaagtgttgcaggaaggggctggcaat
aaccttatccttcaaagcacaaacaagacctgcagccattatgagtgtgcatttctaggt
ggactaaaaactgaaaactgtgttgagaacctagaatattttcaacccgtctatgtctac
aaccctggtgagaaaacccagaagcttgaagaccacgcttatttttgtgactcaggtgag
aaaaatcagaagcttgaagaccgtggtgtgaaaatccttgaacccaccgaaataccagga
atgaaaattccagaaccttttccagtacctgaagataaaagtcaaggaaatatcaacaat
cctactccaggtccagttcctgttccaggtcccaaaagccatccttctgcatccttgggc
aaaatgctgcttccagagtttgggatggtcatcattttaatcagtgtttctgctataaat
ctctttgttgctctgtag

DBGET integrated database retrieval system