KEGG   Macaca mulatta (rhesus monkey): 100425223Help
Entry
100425223         CDS       T01028                                 

Gene name
CYCS
Definition
(RefSeq) cytochrome c, somatic
  KO
K08738  cytochrome c
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc01100  Metabolic pathways
mcc01524  Platinum drug resistance
mcc04115  p53 signaling pathway
mcc04210  Apoptosis
mcc04215  Apoptosis - multiple species
mcc04932  Non-alcoholic fatty liver disease (NAFLD)
mcc05010  Alzheimer's disease
mcc05012  Parkinson's disease
mcc05014  Amyotrophic lateral sclerosis (ALS)
mcc05016  Huntington's disease
mcc05134  Legionellosis
mcc05145  Toxoplasmosis
mcc05152  Tuberculosis
mcc05161  Hepatitis B
mcc05164  Influenza A
mcc05167  Kaposi's sarcoma-associated herpesvirus infection
mcc05168  Herpes simplex infection
mcc05200  Pathways in cancer
mcc05210  Colorectal cancer
mcc05222  Small cell lung cancer
mcc05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    100425223 (CYCS)
   04215 Apoptosis - multiple species
    100425223 (CYCS)
   04115 p53 signaling pathway
    100425223 (CYCS)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100425223 (CYCS)
   05210 Colorectal cancer
    100425223 (CYCS)
   05222 Small cell lung cancer
    100425223 (CYCS)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100425223 (CYCS)
   05012 Parkinson's disease
    100425223 (CYCS)
   05014 Amyotrophic lateral sclerosis (ALS)
    100425223 (CYCS)
   05016 Huntington's disease
    100425223 (CYCS)
  Cardiovascular diseases
   05416 Viral myocarditis
    100425223 (CYCS)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100425223 (CYCS)
  Infectious diseases
   05134 Legionellosis
    100425223 (CYCS)
   05152 Tuberculosis
    100425223 (CYCS)
   05164 Influenza A
    100425223 (CYCS)
   05161 Hepatitis B
    100425223 (CYCS)
   05168 Herpes simplex infection
    100425223 (CYCS)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100425223 (CYCS)
   05145 Toxoplasmosis
    100425223 (CYCS)
  Drug resistance
   01524 Platinum drug resistance
    100425223 (CYCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 100425223
NCBI-ProteinID: XP_014989369
Position
3
AA seq 138 aa AA seqDB search
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGTPW
GEDTLMEYLENPKKYIPGTKMIFVGTKKNEERADLIAYLKKLLMSNNWPLPYLLQNKCLM
TFLCVPYFNRSHTPEFRS
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatgttgagaaaggcaagaagatttttattatgaagtgttcccagtgccacacc
gttgaaaagggaggcaagcacaagactgggccaaatctccatggtctcttcgggcggaag
acaggtcaggcccctggatactcttacacagccgccaataagaacaaaggcacaccctgg
ggagaggatacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgttggcactaagaagaacgaagaaagggcagacttgatagcttatctcaaa
aagctactaatgagtaataattggccactgccttatttattacaaaacaaatgtctcatg
acttttttatgtgtaccatactttaatagatctcatacaccagaattcagatcatga

DBGET integrated database retrieval system