KEGG   Macaca mulatta (rhesus monkey): 100426255Help
Entry
100426255         CDS       T01028                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100426255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 299 aa AA seqDB search
MDRVFVQLTVTSPAGREPWPETVSGNGSNSGSYSGDASGAVTVWEVVSLLGKLLGTVAAL
KVVLYLLRVCLAMAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMD
SPQSIGFQATISAPHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTGKVIG
IDHIKELVDDSINNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQA
LIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggacagagtttttgtacaacttacagtaacaagtccggccgggcgcgagccgtggcct
gaaactgtttccggcaacggcagtaacagcggcagctacagcggggacgcgagcggggcg
gtgacggtgtgggaggtggtctcactcttgggaaaactgctgggcaccgtcgctgcgctg
aaggtggttctgtacctgctccgagtgtgcttagcgatggcctggaaatccggcggcgcc
agccactcggagctaatccacaatctccgcaaaaacggaatcatcaagacagataaagta
tttgaagtgatgctagctacagaccgctctcactatgcaaaatgtaacccttacatggat
tctccacaatcaataggtttccaagcaacaatcagtgctccacacatgcatgcatatgca
ctagaacttctatttgatcagttgcatgaaggagctaaagctcttgatgtaggatctgga
agtggaatccttactgcatgttttgcacgtatggttggatgtactggaaaagtcatagga
attgatcacattaaagagctagtagatgactcaataaataatgtcaggaaggacgatcca
acacttctgtcttcagggagagtacagcttgttgtgggggatggaagaatgggatatgct
gaagaagccccttatgacgccattcatgtaggagctgcagcccccgttgtaccccaggca
ctaatagaccagttaaagcctggaggaagattgatattgccagttggtcctgcaggtgga
aaccaaatgttggagcagtatgacaagctacaagatggcagcgtcaaaatgaagcctctg
atgggggtgatatacgtgcctttaacagataaagaaaagcagtggtccaggtggaagtga

DBGET integrated database retrieval system