KEGG   Macaca mulatta (rhesus monkey): 100426338Help
Entry
100426338         CDS       T01028                                 

Gene name
PNPLA6
Definition
(RefSeq) patatin like phospholipase domain containing 6
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100426338 (PNPLA6)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100426338 (PNPLA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
19
AA seq 1366 aa AA seqDB search
MGTSSHGLATNSSGAKVGERDGFQDVPEPGEVSAGRICGAQPVPFVPQVLGVMIGAGVAV
VVTAVLILLVVRRLRVPKTPAPDGPRYRFRKRDKVLFYGRKIMRKVSQSTSSLVDTSVSA
TSRPRMKKKLKMLNIAKKILRIQKETPTLQRKEPPPAVLEADLTEGDLANSHLPSEVLYM
LKNVRVLGHFEKPLFLELCRHMVFQRLGQGDYVFRPGQPDASIYVVQDGLLELCLPGPDG
KECVVKEVVPGDSVNSLLSILDVITGHQHPQRTVSARAARDSTVLRLPVEAFSAVFTKYP
ESLVRVVQIIMVRLQRVTFLALHNYLGLTNELFSHEIQPLRLFPSPGLPTRTSPVRGSKR
MVSTSATDEPRETPGRPPDPTGAPLPGPTGDPVKPTSLETTSAPLLSRCVSMPGDISGLQ
GGPRSDFDMAYERGRISVSLQEEASGGSQATPARTPTQEPREQPAGACEYSYCEDESATG
GCPFGPYQGRQTSSIFEAAKRELAKLMRIEDPSLLNSRVLLHHAKAGTIIARQGDQDVSL
HFVLWGCLHVYQRMIDKAEDVCLFVAQPGELVGQLAVLTGEPLIFTLRAQRDCTFLRISK
SDFYEIMRAQPSVVLSAAHTVAARMSPFVRQMDFAIDWTAVEAGRALYRQGDRSDCTYIV
LNGRLRSVIQRGSGKKELVGEYGRGDLIGVVEALTRQPRATTVHAVRDTELAKLPEGTLG
HIKRRYPQVVTRLIHLLSQKILGNLQQLQGPFPAGSGLGVPPHSELTNPASNLATVAVLP
VCAEVPMVAFTLELQHALQAIGPTLLLNSDIIRARLGASALDSIQEFRLSGWLAQQEDAH
RIVLYQTDASLTPWTVRCLRQADCILIVGLGDQEPTLGQLEQMLENTAVRALKQLVLLHR
EEGAGPTRTVEWLNMRSWCSGHLHLRCPRRLFSRRSPAKLHELYEKVFSRRADRHSDFSR
LARVLTGNTIALVLGGGGARGCSHIGVLKALEEAGVPVDLVGGTSIGSFIGALYAEERSA
SRTKQRAREWAKSMTSVLEPVLDLTYPVTSMFTGSAFNRSIHRVFQDKQIEDLWLPYFNV
TTDITASAMRVHKDGSLWRYVRASMTLSGYLPPLCDPKDGHLLMDGGYINNLPADIARSM
GAKTVIAIDVGSQDETDLSTYGDSLSGWWLLWKRLNPWADKVKVPDMAEIQSRLAYVSCV
RQLEVVKSSSYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGGWSRGNVIEKMLTD
RRSADLNESRRADVLAFPSSGFTDLAEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAG
PDCSRDEGGSPEGASPSTASEMEEEKSILRHRHCLPQEPPGSTTDA
NT seq 4101 nt NT seq  +upstreamnt  +downstreamnt
atggggacatcgagtcacgggctggctaccaactcctcgggggcgaaggtgggggagagg
gatgggttccaggacgtcccggagcccggggaagtctcggcgggacggatttgcggtgcg
cagccagtgccgtttgtccctcaggtgctgggcgtgatgatcggggccggagtggcggtg
gtggtcacggccgtgctcatcctcctggtggtgcggaggctgcgagtgccaaaaacccca
gccccggatggcccccggtatcggttccggaagagggacaaagtgctgttctatggccgg
aagattatgcggaaggtgtcacaatccacgtcctccctcgtggatacctctgtctccgcc
acttcccggccacgcatgaagaagaaactgaagatgctcaacattgccaagaagattctg
cgcatccagaaagagacccccacgctgcagcggaaggagccccctcccgcagtgctggaa
gctgacctgaccgagggcgacctggctaactcccatctgccctccgaagtgctttatatg
ctcaagaacgtccgggtgctgggccacttcgagaagccgctcttcctggagctctgccgc
cacatggtcttccagcggctgggccagggtgactacgtcttccggccaggccagccagat
gccagcatctacgtggtgcaggacgggctgctggagctctgtctgccggggcctgacggg
aaggagtgtgtggtgaaggaagtggttcccggggacagcgtcaacagccttctcagcatc
ctggatgtcatcaccggtcaccagcatccccagcggaccgtgtctgcccgggcggcccgg
gactccacagtgctgcgcctgcccgtggaagcgttctccgcggtcttcaccaagtacccg
gagagcttggtgcgggtcgtgcagatcatcatggtgcggctgcagcgagtcaccttcttg
gcgctgcacaactacctgggtctgaccaatgagctcttcagccacgagatccagccgctg
cgtctgttccccagccccggcctcccaactcgcaccagccctgtgcggggctccaagagg
atggtcagcacctcagctacagacgagcccagggagacgccaggccggccacctgacccc
accggggccccgctgcctggacctacaggggaccccgtgaagcccacatccctggaaacc
acctcggcccctctgctgagccgctgcgtctccatgccaggggacatctcaggcttgcag
ggtggcccccgctccgactttgacatggcctatgagcgtggccggatctccgtgtccctg
caggaagaggcctccggggggtcccaagcaacccccgctcggacccctactcaggagccc
cgtgagcagccagcaggcgcctgcgaatacagctactgtgaggatgagtcggccaccggc
ggctgccccttcgggccctaccagggtcgccagaccagcagcatcttcgaggcagcaaag
cgggagctggccaagctgatgcggatcgaggacccctccctcctgaacagccgagtcttg
ctgcaccacgctaaagctggcaccatcattgcccgccagggagaccaggacgtgagcctg
cacttcgtgctctggggctgcctgcacgtgtaccagcgcatgattgacaaggcggaggac
gtgtgcctgtttgtagcgcagcccggggagctggtggggcagctggcggtgctcactggc
gaacctctcatcttcacgctgcgagcccagcgcgactgcaccttcctgcggatctccaag
tccgacttctacgagatcatgcgcgcacagcccagtgtggtgctgagcgcggcgcacacg
gtggcagccaggatgtcgcccttcgtacgccagatggacttcgccatcgactggacggca
gtggaggcgggacgcgcgctgtacaggcagggggaccgctccgactgcacttacatcgtg
ctcaatggacggctgcgtagcgtgatccagcgaggcagtggcaagaaggagctggtgggc
gagtacggccgcggcgacctcatcggcgtggtggaggcgctgacccggcagccgcgagcc
acgacggtgcacgcggtgcgagacacggagctggccaagcttcccgagggcaccttgggt
cacatcaaacgccggtacccgcaggttgtgacccgtcttatccacctgctgagccagaaa
attctaggaaatttgcagcagctgcaaggacccttcccagcaggctctgggctgggtgtg
cccccacactcggaactcaccaacccagccagcaacctggcaacggtggcagtcctgccc
gtgtgtgctgaggtccccatggtggccttcacgctggagctgcagcatgccctgcaggcc
attggtccgacgctactgcttaacagtgacatcatccgggcacgcctgggggcctccgca
ctggatagcatccaagagttccggctgtcagggtggctggcccagcaggaggatgcacac
cgtatcgtactttaccagacggacgcctcgctgacgccctggaccgtgcgctgcctgcga
caggccgactgcatcctcatcgtgggcctgggggaccaggagcccaccctcggccagctg
gagcaaatgctggagaacacggcagtgcgcgcccttaagcagctcgtcctgctccaccga
gaggagggcgcgggccccacgcgcaccgtggagtggctcaacatgcgcagctggtgctcg
gggcacctgcacctgcgctgtccgcgccgcctgttctcgcgccgcagccctgccaagctg
catgagctctacgagaaggttttctccaggcgtgcggaccggcacagcgacttctcccgc
ttggcgagggtgctcacagggaacaccattgcccttgtgctgggcgggggcggggccagg
ggctgctcgcacatcggagtgctaaaggcattagaggaggcgggggtccccgtggaccta
gtgggcggcacgtccattggctctttcatcggagcgttgtacgcggaggagcgcagcgcc
agccgcacgaagcagcgcgcccgggagtgggccaagagcatgacttcagtgctggaacct
gtgttggacctcacgtacccagttacctccatgttcactgggtctgcctttaaccgcagc
atccaccgggtcttccaggataaacagattgaggacctgtggctgccttacttcaacgtg
accacagatatcaccgcctcagccatgcgagtccacaaagatggctccctgtggcggtat
gtgcgcgccagcatgacgctatcgggctacctgccgccgctgtgcgaccccaaggacggg
cacctactcatggatggcggctacatcaacaacctgccagcggacatcgcccgcagcatg
ggtgccaaaacggtcatcgccatcgatgtggggagccaggacgagacggacctcagcacc
tacggggacagcctgtctggctggtggctgctgtggaagcggctgaatccctgggcggac
aaggtgaaggttccagacatggctgaaatccagtcccgcctggcctacgtgtcctgcgtg
cggcagctagaggttgtcaagtccagctcctactgcgagtacctgcgcccgcccatcgac
tgcttcaagaccatggacttcgggaagttcgaccagatctatgatgtgggctaccagtac
gggaaggcagtgtttggaggctggagccgtggcaacgtcattgagaaaatgctcacagac
cggcggtctgcagaccttaatgagagccgccgtgcagacgtgcttgccttcccaagctct
ggcttcaccgacttggcagagatcgtgtcccggattgagccccccacaagctatgtctcc
gatggctgtgctgacggagaggagtcagattgtctgacagagtatgaggaggacgccgga
cccgactgctcgagggatgaaggggggtccccggagggcgcaagccccagcactgcctct
gagatggaggaggagaagtcgattctccggcaccgacactgtctgccccaggagccgccc
ggctcaaccacagatgcctga

DBGET integrated database retrieval system