KEGG   Macaca mulatta (rhesus monkey): 100427327Help
Entry
100427327         CDS       T01028                                 

Definition
UDP-glucuronosyltransferase 2B23-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100427327
   00053 Ascorbate and aldarate metabolism
    100427327
   00500 Starch and sucrose metabolism
    100427327
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100427327
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100427327
   00860 Porphyrin and chlorophyll metabolism
    100427327
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100427327
   00982 Drug metabolism - cytochrome P450
    100427327
   00983 Drug metabolism - other enzymes
    100427327
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100427327
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100427327
Glycosyltransferases [BR:mcc01003]
 Others
  Hydrophobic molecule
   100427327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFYFSSGSCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTALASSA
SILFDPNNSSALKIEVFPTSLPKPEFENIVTQEIKRWIELPKDTFWLYFSQMQEIMWKFG
DIFRNFCKDVVSNKKLMKKLQESRFDVVFADPIFPCSELLAELLNIPLVYSLRFTPGYVF
EKHCGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYMLYFDFCFQIYDMKKWDQFYSEVL
GRHTTLSEIMGKADIWLIRNSWNFQFPHPLLPNVDFIGGLLCKPAKPLPKEMEEFVQSSG
ENGVVVFTLGSMITNMKEERANVIASALAQIPQKVLWRFDGNKPDTLGVNTRLYKWIPQN
DLLGHPKTKAFITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTRGAAVQLDFDTM
SSTDLVNALKTVINDPLYKENVMKLSRIQRDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWFQYHSLDVIGFLLACVATVIFIIMKCCLFCFWKFTRKGKKGKSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattctgctaatacaactgagcttttactttagctct
gggagttgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatatgaag
acaatcctggaagagcttgtccagagaggtcatgaggtgactgcactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaagtttttcctacatct
ttacctaaacctgagtttgagaatatagtcacgcaagagattaagagatggatagaactt
ccaaaagatacattttggttatatttttcacaaatgcaagaaatcatgtggaagtttggt
gacatatttagaaacttctgtaaagatgtagtttcaaataagaaattaatgaagaaacta
caagagtcaagatttgacgtcgtttttgcagatcctatttttccctgtagtgagctgctg
gctgagctacttaacataccacttgtgtacagtctccgcttcactcctggctatgttttt
gaaaagcattgtggaggatttcttttccctccctcctacgtacctgttgttatgtcagaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatatgctttatttt
gacttttgtttccaaatatatgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacacactacattatctgagataatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttattggaggactc
ctctgcaaacctgccaaacccctacctaaggaaatggaagaatttgtacagagctctgga
gaaaacggtgttgtggtgtttactctggggtcaatgatcactaacatgaaagaagaaagg
gccaacgtaattgcatcagcccttgcccagattccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtgtcaatactcggctctataagtggataccccagaat
gaccttctaggtcatccaaaaaccaaagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatggggtccctatggtgggcattccactgtttgccgatcaacct
gataacattgctcacatgaaaaccagaggagcagctgttcaactggacttcgacacaatg
tcgagtacagacttggtgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacgtgatcagccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcggcctgcagcc
catgacctcacctggttccagtatcactctttggatgtgattgggttcctgctggcctgt
gtggccactgtgatatttatcatcatgaaatgttgtctgttttgtttctggaagtttact
agaaaaggaaagaagggaaaaagtgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system