KEGG   Macaca mulatta (rhesus monkey): 100428682Help
Entry
100428682         CDS       T01028                                 

Gene name
PPP3R1
Definition
(RefSeq) protein phosphatase 3 regulatory subunit B, alpha
  KO
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100428682 (PPP3R1)
   04310 Wnt signaling pathway
    100428682 (PPP3R1)
   04370 VEGF signaling pathway
    100428682 (PPP3R1)
   04020 Calcium signaling pathway
    100428682 (PPP3R1)
   04022 cGMP - PKG signaling pathway
    100428682 (PPP3R1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100428682 (PPP3R1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    100428682 (PPP3R1)
   04660 T cell receptor signaling pathway
    100428682 (PPP3R1)
   04662 B cell receptor signaling pathway
    100428682 (PPP3R1)
  Endocrine system
   04922 Glucagon signaling pathway
    100428682 (PPP3R1)
   04921 Oxytocin signaling pathway
    100428682 (PPP3R1)
   04924 Renin secretion
    100428682 (PPP3R1)
  Nervous system
   04724 Glutamatergic synapse
    100428682 (PPP3R1)
   04720 Long-term potentiation
    100428682 (PPP3R1)
  Development
   04360 Axon guidance
    100428682 (PPP3R1)
   04380 Osteoclast differentiation
    100428682 (PPP3R1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    100428682 (PPP3R1)
   05014 Amyotrophic lateral sclerosis (ALS)
    100428682 (PPP3R1)
  Substance dependence
   05031 Amphetamine addiction
    100428682 (PPP3R1)
  Infectious diseases
   05152 Tuberculosis
    100428682 (PPP3R1)
   05166 HTLV-I infection
    100428682 (PPP3R1)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100428682 (PPP3R1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
13
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgcggatgaaatt
aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg
gaagagttcatgtctctgcctgagttacaacagaatcctttagtacagcgagtaatagat
atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggcgtctct
cagttcagtgtcaaaggagataaggagcagaagttgaggtttgctttccgtatctatgac
atggataaagatggctatatttccaatggggaactcttccaggtattgaagatgatggtg
gggaacaatctgaaagatacacagttacagcaaattgtagacaaaaccataataaatgca
gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta
gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system