KEGG   Macaca mulatta (rhesus monkey): 574147Help
Entry
574147            CDS       T01028                                 

Gene name
UGT2B33
Definition
UDP-Glucuronosyltransferase UGT2B33 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574147 (UGT2B33)
   00053 Ascorbate and aldarate metabolism
    574147 (UGT2B33)
   00500 Starch and sucrose metabolism
    574147 (UGT2B33)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    574147 (UGT2B33)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574147 (UGT2B33)
   00860 Porphyrin and chlorophyll metabolism
    574147 (UGT2B33)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574147 (UGT2B33)
   00982 Drug metabolism - cytochrome P450
    574147 (UGT2B33)
   00983 Drug metabolism - other enzymes
    574147 (UGT2B33)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    574147 (UGT2B33)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574147 (UGT2B33)
Glycosyltransferases [BR:mcc01003]
 Others
  Hydrophobic molecule
   574147 (UGT2B33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 529 aa AA seqDB search
MSVKWTSIILLIQLSFYFSSGSCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSA
SILFDPNNSSALKIEVFPTSLTKTEFENIIRQQIKRWSELPKDTFWLYFSQIQEIMWRFG
DISIKFCKDVVSNKKLMKKLQESRFDVVLADPIFPCSELLAELFNIPLVYSLRFTPGYVF
EKHCGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYVLYFDFCFQLYDMKKWDQFYSEVL
GRHTTLSEIMGKADIWLIRNSWNFQFPHPLLPNVDFIGGLLCKPAKPLPKEMEEFVQSSG
ENGVVVFTLGSMITNMKEERANVIASALAQIPQKVLWRFDGNKPDTLGVNTRLYKWIPQN
DLLGHPKTKAFITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTRGAAVQLDFDTM
SSTDLANALKTVINDPLYKENVMKLSRIQRDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWFQYHSLDVIGFLLACVATVIFIIMKCCLFCFWKFTRKGKKGKSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcaataattctgctaatacaactgagcttttactttagctct
gggagttgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatatgaag
acaatcctggaagagcttgtccagaggggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaagtttttcctacatct
ttaactaaaacggagtttgagaatatcatcaggcaacagattaagagatggtcagaactt
ccaaaagatacattttggttatatttttcacaaatacaagaaatcatgtggaggtttggt
gacataagtataaagttctgtaaagatgtagtttcaaataagaaattaatgaagaaacta
caagagtcaagatttgatgtcgttttagcagatcctatttttccctgtagtgagctgctg
gctgagctatttaacataccccttgtgtacagtctccgcttcactcctggctacgttttt
gaaaaacattgtggaggatttcttttccctccctcctacgtacctgttgttatgtcagaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttgtttccaattgtatgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacacactacattatctgagataatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttattggaggactc
ctctgcaaacctgccaaacccctacctaaggaaatggaagaatttgtacagagctctgga
gaaaatggtgttgtggtgtttactctggggtcaatgatcactaacatgaaagaagaaagg
gccaacgtaattgcatcagcccttgcccagattccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtgtcaatactcggctctataagtggataccccagaat
gaccttctaggtcatccaaaaaccaaagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatggggtccctatggtgggcattccactgtttgccgatcaacct
gataacattgctcacatgaaaaccagaggagcagctgttcaattggacttcgacacaatg
tcgagtacagacttggcgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacgtgatcagccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcggcctgcagcc
catgacctcacctggttccagtatcactctttggatgtgattgggttcctgctggcctgt
gtggccactgtgatatttatcatcatgaaatgttgtctgttttgtttctggaagtttact
agaaaaggaaagaagggaaaaagtgattag

DBGET integrated database retrieval system