KEGG   Macaca mulatta (rhesus monkey): 574147Help
Entry
574147            CDS       T01028                                 

Gene name
UGT2B33
Definition
(RefSeq) UDP-Glucuronosyltransferase UGT2B33
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00040  Pentose and glucuronate interconversions
mcc00053  Ascorbate and aldarate metabolism
mcc00140  Steroid hormone biosynthesis
mcc00830  Retinol metabolism
mcc00860  Porphyrin and chlorophyll metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc00982  Drug metabolism - cytochrome P450
mcc00983  Drug metabolism - other enzymes
mcc01100  Metabolic pathways
mcc05204  Chemical carcinogenesis
Module
mcc_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    574147 (UGT2B33)
   00053 Ascorbate and aldarate metabolism
    574147 (UGT2B33)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    574147 (UGT2B33)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    574147 (UGT2B33)
   00860 Porphyrin and chlorophyll metabolism
    574147 (UGT2B33)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    574147 (UGT2B33)
   00982 Drug metabolism - cytochrome P450
    574147 (UGT2B33)
   00983 Drug metabolism - other enzymes
    574147 (UGT2B33)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    574147 (UGT2B33)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     574147 (UGT2B33)
Glycosyltransferases [BR:mcc01003]
 Others
  Hydrophobic molecule
   574147 (UGT2B33)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 574147
NCBI-ProteinID: NP_001028002
Ensembl: ENSMMUG00000000337
UniProt: Q9GLD9
Position
5
AA seq 529 aa AA seqDB search
MSVKWTSIILLIQLSFYFSSGSCGKVLVWAAEYSHWMNMKTILEELVQRGHEVTVLASSA
SILFDPNNSSALKIEVFPTSLTKTEFENIIRQQIKRWSELPKDTFWLYFSQIQEIMWRFG
DISIKFCKDVVSNKKLMKKLQESRFDVVLADPIFPCSELLAELFNIPLVYSLRFTPGYVF
EKHCGGFLFPPSYVPVVMSELSDQMTFMERVKNMIYVLYFDFCFQLYDMKKWDQFYSEVL
GRHTTLSEIMGKADIWLIRNSWNFQFPHPLLPNVDFIGGLLCKPAKPLPKEMEEFVQSSG
ENGVVVFTLGSMITNMKEERANVIASALAQIPQKVLWRFDGNKPDTLGVNTRLYKWIPQN
DLLGHPKTKAFITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTRGAAVQLDFDTM
SSTDLANALKTVINDPLYKENVMKLSRIQRDQPVKPLDRAVFWIEFVMRHKGAKHLRPAA
HDLTWFQYHSLDVIGFLLACVATVIFIIMKCCLFCFWKFTRKGKKGKSD
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcaataattctgctaatacaactgagcttttactttagctct
gggagttgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatatgaag
acaatcctggaagagcttgtccagaggggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaagtttttcctacatct
ttaactaaaacggagtttgagaatatcatcaggcaacagattaagagatggtcagaactt
ccaaaagatacattttggttatatttttcacaaatacaagaaatcatgtggaggtttggt
gacataagtataaagttctgtaaagatgtagtttcaaataagaaattaatgaagaaacta
caagagtcaagatttgatgtcgttttagcagatcctatttttccctgtagtgagctgctg
gctgagctatttaacataccccttgtgtacagtctccgcttcactcctggctacgttttt
gaaaaacattgtggaggatttcttttccctccctcctacgtacctgttgttatgtcagaa
ttaagtgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttatttt
gacttttgtttccaattgtatgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacacactacattatctgagataatggggaaagctgacatatggcttattcgaaac
tcctggaattttcagtttccacatccactcttaccaaatgttgattttattggaggactc
ctctgcaaacctgccaaacccctacctaaggaaatggaagaatttgtacagagctctgga
gaaaatggtgttgtggtgtttactctggggtcaatgatcactaacatgaaagaagaaagg
gccaacgtaattgcatcagcccttgcccagattccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtgtcaatactcggctctataagtggataccccagaat
gaccttctaggtcatccaaaaaccaaagcttttataactcacggtggagccaatggcatc
tacgaggcaatctaccatggggtccctatggtgggcattccactgtttgccgatcaacct
gataacattgctcacatgaaaaccagaggagcagctgttcaattggacttcgacacaatg
tcgagtacagacttggcgaatgcactgaagacagtaattaatgatcctttatataaagag
aatgttatgaaattatcaagaattcaacgtgatcagccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcggcctgcagcc
catgacctcacctggttccagtatcactctttggatgtgattgggttcctgctggcctgt
gtggccactgtgatatttatcatcatgaaatgttgtctgttttgtttctggaagtttact
agaaaaggaaagaagggaaaaagtgattag

DBGET integrated database retrieval system