KEGG   Macaca mulatta (rhesus monkey): 574238Help
Entry
574238            CDS       T01028                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     574238 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 291 aa AA seqDB search
MALASLMMALGCLGLHTWQAQAVPILPLGLAPDTFDDAYVGCAEEMEEKAAPLLKAEMAH
HALLRESWEAAQEAWEDRHRGLTLPPGFKAQNGIAIMVYTNSSNTLYWKLNQAVRTGGGS
RELYMRHFPFKALHFYLIRALQLLGGGGGCSTGPGEVVFRGVGSLRFEPKRLGDSVRLGQ
FASSSLDKAVACRFGNATLFSLTTCFGAPIQAFSVFPKEREVLIPPHEVFLVTRFSQDGA
QSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDLHMKKRRLQQP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcactggcgtcactgatgatggccctcggctgccttggcctccacacctggcaggcc
caggctgttcccatcctgcccctgggactggctccagacacctttgacgatgcctatgtg
ggttgtgcagaggagatggaggagaaggcagcccccctgctaaaggcggaaatggcccac
catgccctgcttcgggaatcctgggaggcagcccaggaggcctgggaggacaggcatcga
gggctcaccttaccccctggcttcaaagcccagaatggaatagccattatggtctacacc
aactcatctaacaccttgtactggaagttgaatcaggccgtgcggacaggcggaggctcc
cgggagctctacatgaggcactttcccttcaaggccctgcatttctacctgatccgggcc
ctgcagctgcttggaggcggtgggggctgcagcacagggcctggggaggtggtgttccga
ggtgtgggcagccttcgctttgaacccaaaaggctgggggactctgtccgcttaggccag
tttgcctccagctccctggataaggcagtggcctgcagatttggtaatgccaccctcttt
tctctaacgacttgctttggggcccctatccaggccttctctgtctttcccaaggagcgc
gaggtgctgattcccccccatgaagtcttcttggtcaccagattctctcaggatggagcc
cagagcctggtgactctctggagctataatcagacctgcagccactttaactgcgcctat
ctgggtggggagaagaggcggggctgtgtgtctgcaccaggagccctgggaacgggtgac
cttcatatgaagaagaggcgcctccaacagccttga

DBGET integrated database retrieval system