KEGG   Macaca mulatta (rhesus monkey): 574258Help
Entry
574258            CDS       T01028                                 

Gene name
PPP3R2
Definition
protein phosphatase 3, regulatory subunit B, beta (EC:3.1.3.16)
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Alzheimer's disease
Amyotrophic lateral sclerosis (ALS)
Amphetamine addiction
Tuberculosis
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    574258 (PPP3R2)
   04310 Wnt signaling pathway
    574258 (PPP3R2)
   04370 VEGF signaling pathway
    574258 (PPP3R2)
   04020 Calcium signaling pathway
    574258 (PPP3R2)
   04022 cGMP - PKG signaling pathway
    574258 (PPP3R2)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    574258 (PPP3R2)
   04210 Apoptosis
    574258 (PPP3R2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    574258 (PPP3R2)
   04660 T cell receptor signaling pathway
    574258 (PPP3R2)
   04662 B cell receptor signaling pathway
    574258 (PPP3R2)
  Endocrine system
   04921 Oxytocin signaling pathway
    574258 (PPP3R2)
  Nervous system
   04724 Glutamatergic synapse
    574258 (PPP3R2)
   04720 Long-term potentiation
    574258 (PPP3R2)
  Development
   04360 Axon guidance
    574258 (PPP3R2)
   04380 Osteoclast differentiation
    574258 (PPP3R2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    574258 (PPP3R2)
   05014 Amyotrophic lateral sclerosis (ALS)
    574258 (PPP3R2)
  Substance dependence
   05031 Amphetamine addiction
    574258 (PPP3R2)
  Infectious diseases
   05152 Tuberculosis
    574258 (PPP3R2)
   05166 HTLV-I infection
    574258 (PPP3R2)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     574258 (PPP3R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
15
AA seq 173 aa AA seqDB search
MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR
VIDVFDTNGDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK
MMVGNNLPDWQLQQLVDKTILILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaatgggaaacgaggccagttacccggcggagatgtgcgcccactttgacaat
gatgaaattaaaaggctgggcaggaggtttcggaagttggacttggacaaatcaggctct
ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga
gtgatcgacgtcttcgacaccaacggcgatggagaagtggacttcaaggaattcatcctg
gggacctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgtttagc
atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag
atgatggtgggcaacaacctgccggactggcagctccagcagctggtcgacaaaaccatc
ctcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc
agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system