KEGG   Macaca mulatta (rhesus monkey): 574276Help
Entry
574276            CDS       T01028                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    574276 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    574276 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    574276 (THBS4)
  Cell communication
   04510 Focal adhesion
    574276 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    574276 (THBS4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   574276 (THBS4)
  Exosomal proteins of colorectal cancer cells
   574276 (THBS4)
  Exosomal proteins of bladder cancer cells
   574276 (THBS4)
Heparan sulfate/heparin binding proteins [BR:mcc00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  574276 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 961 aa AA seqDB search
MLAPRGAAVLLLHLVLQPWLAAGAQATPQVFDLLPSSSQRVNPGALLPVLTDQALNDLYV
ISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLA
DGRRHRLLLRLSNLQRGAGSLELYLDCIQVDSIHNLPRAFAGLSQNPETIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVRCVNLSPGFRCDACPVGFTGP
MVQGVGISFAKSNKQVCTDIDECRNGACVSNSICINTLGSYRCGPCKPGYTGDQIRGCKM
ERNCRNPELNPCSVNARCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
DACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPRFPNRDQRDKDGDGVGD
ACDSCPDISNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLD
N
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgccgtcctcctgctgcacctggtcctgcagccgtggctg
gcggccggcgcccaggccaccccccaggtctttgaccttctcccatcttccagtcagagg
gtgaacccaggcgctctgctgccagtcctgacagatcaagctctgaatgatctctatgtg
atttccaccttcaagctgcagactaaaagttcagccaccatcttcggtctttactcttca
actgacaacagtaaatattttgaatttactgtgatgggacgcttaaacaaagccatcctc
cgttacctgaagaacgacgggaaggtccatttggtggttttcaacaacctgcagctggca
gacggaaggcggcacaggctcctcctgaggctgagcaatttgcagcgaggggctggctcc
ctagagctctacctggactgcatccaggtggattccattcacaatctccccagggccttt
gccggcctctcccagaatcctgagaccattgaattgaggactttccagaggaagccacag
gacttcttggaagagctgaagctggtggtgagaggctcactgttccaggtggccagcctg
caagactgcttcctgcagcagagcgagccgctggctgccacaggcacaggggactttaac
cggcagttcttgggtcaaatgacacaattaaaccaactcctgggagaggtgaaggacctt
ctgcgacagcaggttaaggaaacatcatttttgcgaaacaccatagctgaatgccaggct
tgcggtcctctcaagtttcagtctccaaccccaagcaccgtggtacccccagcaccccct
gcaccgccaacacgcccacctcgccggtgtgactccaacccatgtttccgaggtgtccaa
tgtaccgacagcagagatggcttccagtgtgggccctgccccgagggctacacaggaaac
gggatcacctgcattgatgtggatgagtgcaaataccatccctgctacccaggcgtgcgc
tgcgtgaatttgtctcctggcttcagatgtgacgcctgcccagtgggcttcacagggccc
atggtgcagggtgttgggatcagttttgccaagtcaaacaagcaggtctgcactgacatt
gatgagtgtcgaaatggagcatgcgtttccaactcgatctgcattaatactttgggatct
taccgctgtgggccttgcaagccagggtatactggtgatcagataagaggatgcaaaatg
gaaagaaactgcagaaacccagagctgaacccttgcagtgtgaatgcccggtgcattgaa
gagaggcagggggatgtgacatgtgtgtgtggagtcggttgggctggcgatggctatgtc
tgtggaaaggatgtggacatcgacagttaccctgatgaagaactgccatgctctgccagg
aactgtaagaaggacaactgcaagtatgtgccaaattctggccaggaagatgcagacaga
gatggcattggcgacgcttgtgacgaggatgctgatggagacgggatcctgaatgagcag
gataactgtgtcctgattcacaatgtggaccaaaggaacagcgataaagatatctttgga
gatgcctgtgataactgcctgagtgtcttaaataatgaccagaaagacacagatggggat
ggaagaggagatgcctgtgatgatgacatggatggagatggaataaaaaacattctggac
aactgcccaagatttcccaatcgtgaccaacgggacaaggatggtgatggtgtgggggac
gcctgtgacagttgtcctgatatcagcaaccctaaccagtctgatgtggataatgatctg
gttggggactcctgtgacaccaatcaggacagtgatggagatgggcaccaggacagcaca
gacaactgccccaccgtcattaacagtgcccagctggacaccgataaggatggaattggt
gacgagtgtgatgatgatgatgacaatgatggtatcccagacctggtgccccctggacca
gacaactgccggctggtccccaacccagcccaggaggatagcaacagcgacggagtggga
gacatctgtgagtctgactttgaccaggaccaggtcatcgatcggatcgatgtctgccca
gagaacgcagaggtcaccctgaccgacttcagggcttaccagaccgtggtcctggatcct
gaaggggatgcccagatcgatcccaactgggtggtcctgaaccagggcatggagattgtg
cagaccatgaacagtgatcctggcctggcagtggggtacacggcttttaatggagttgac
ttcgaagggaccttccatgtaaatacccagacagatgatgactatgcgggctttatcttt
ggctaccaagatagctccagcttctacgtggtcatgtggaagcagacggagcagacatat
tggcaagccaccccgttccgagcggttgcagaacctggcattcagctcaaggctgtgaag
tctaagacaggtccaggggagcatctccggaactccctgtggcacacgggggacaccagt
gaccaggtcaggctgctgtggaaggattccaggaatgtgggctggaaggacaaggtgtcc
taccgctggttcctacagcacaggccccaggtgggctacatcagggtacgattttatgaa
ggctccgagttggtggctgactctggagtcaccatagacaccacaatgcgtggaggccga
cttggcgttttctgcttctctcaagaaaacatcatctggtccaacctcaagtatcgctgc
aatgacaccatccctgaggacttccaagagtttcaaacccagaatttcgaccgcttggat
aattga

  All links  
No link information was found.   
DBGET integrated database retrieval system