KEGG   Macaca mulatta (rhesus monkey): 574362Help
Entry
574362            CDS       T01028                                 

Gene name
CHRM1, M1
Definition
(RefSeq) cholinergic receptor muscarinic 1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc04020  Calcium signaling pathway
mcc04024  cAMP signaling pathway
mcc04080  Neuroactive ligand-receptor interaction
mcc04151  PI3K-Akt signaling pathway
mcc04725  Cholinergic synapse
mcc04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    574362 (CHRM1)
   04024 cAMP signaling pathway
    574362 (CHRM1)
   04151 PI3K-Akt signaling pathway
    574362 (CHRM1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    574362 (CHRM1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    574362 (CHRM1)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    574362 (CHRM1)
G protein-coupled receptors [BR:mcc04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    574362 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 574362
NCBI-ProteinID: NP_001028117
Ensembl: ENSMMUG00000017292
UniProt: P56489
Position
14
AA seq 460 aa AA seqDB search
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRPPRLLQAYSWKEDEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPTKQPPRSSPNTVKRPTKKGRDRAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaacacttcagccccacctgctgtcagccccaacatcaccgtcctggcaccaggaaag
ggtccctggcaagtggccttcattgggatcaccacgggcctcctgtcgctagccacagtg
acaggcaacctgctggtactcatctccttcaaggtcaacacggagctcaagacagtcaat
aactacttcctgctgagcctggcctgtgctgacctcatcatcggtaccttctccatgaac
ctctataccacgtacctgctcatgggccactgggctctgggcacactggcttgcgacctc
tggctggccctggactatgtggccagcaatgcctccgtcatgaatctgctgctcatcagt
tttgaccgctacttctccgtgactcggcccctgagctaccgcgccaagcgcacaccccgc
cgggcagccctgatgatcggcctggcctggctggtttcctttgtcctctgggccccagcc
atcctcttctggcagtacctggtaggggagcggacagtgctggctgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacagccatggctgccttctacctccct
gtcacagtcatgtgcacgctctactggcgcatctaccgggagacagagaaccgagcacgg
gagctggcagcccttcagggctccgagacgccaggcaaagggggtggcagcagcagcagc
tcagagaggtctcagccaggggctgagggttcaccagagactcctccaggccgttgctgt
cgctgctgccggccccccaggctgctgcaggcctacagctggaaggaagacgaggaagag
gatgaaggctccatggagtccctcacatcctctgagggagaggagcctggctccgaagtg
gtgatcaagatgccaatggtggaccctgaggcacaggctcccaccaagcagcccccccgg
agctccccaaatacagtgaagaggccgactaagaaagggcgtgatcgagctggcaagggc
cagaagccccgtgggaaggagcagctggccaagcggaagaccttctcactggtcaaggag
aagaaggcggctcggaccctgagtgccatcctcctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgttcccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctatgcgctc
tgcaacaaagccttccgggacacctttcgcctgctgctgctttgccgctgggacaagaga
cgctggcgcaagatccccaagcgccctggctccgtgcaccgcactccctcccgccaatgc
tga

DBGET integrated database retrieval system